KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12214
Entry
HMPREF0837_12214  CDS       T01259                                 

Definition
(GenBank) H+ Antiporter protein
  KO
K08217  MFS transporter, DHA3 family, macrolide efflux protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:snc02000]
    HMPREF0837_12214
   01504 Antimicrobial resistance genes [BR:snc01504]
    HMPREF0837_12214
Transporters [BR:snc02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-3 (12 spanner) (DHA3) [TC:2.A.1.21]
    HMPREF0837_12214
Antimicrobial resistance genes [BR:snc01504]
 Gene variants
  Macrolide resistance genes
   Transporters
    HMPREF0837_12214
SSDB
Motif
Pfam: MFS_1 MFS_3 MFS_2
Other DBs
NCBI-ProteinID: ADI70442
UniProt: D6ZP96
Position
complement(2025198..2026415)
AA seq 405 aa
MEKYNNWKRKFYAIWAGQAVSLITSAILQMAIIFYLTEKTGSAMVLSMASLVGFLPYAIL
GPAIGVLVDRHDRKKIMIGADLIIAAAGAVLAIVAFCMELPVWMIMIVLFIRSIGTAFHT
PALNAVTPLLVPEEQLTKCAGYSQSLQSISYIVSPAVAALLYSVWDLNAIIAIDVLGAVI
ASITVAIVRIPKLGNQVQSLEPNFIREMKEGVVVLRQNKGLFALLLLGTLYTFVYMPINA
LFPLISMEHFNGTPVHISITEISFAFGMLAGGLLLGRLGGFEKHVLLITSSFFIMGTSLA
VSGILPPNGFVIFVVCCAIMGLSVPFYSGVQTALFQEKIKPEYLGRVFSLIGSIMSLAMP
IGLILSGFFADKIGVNHWFLLSGILIIGIAIVCQMITEVRKLDLK
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggaaaaatacaacaattggaaacgaaaattttatgcaatatgggcagggcaagcagta
tcattaatcactagtgccatcctgcaaatggcgattattttttaccttacagaaaaaaca
ggatctgcgatggtcttgtctatggcttcattagtaggttttttaccctatgcgattttg
ggacctgccattggtgtgctagtggatcgtcatgataggaagaagataatgattggtgcc
gatttaattatcgcagcagctggtgcagtgcttgctattgttgcattctgtatggagcta
cctgtctggatgattatgatagtattgtttatccgtagcattggaacagcttttcatacc
ccagcactcaatgcggttacaccacttttagtaccagaagaacagctaacgaaatgcgca
ggctatagtcagtctttgcagtctataagctatattgttagtccggcagttgcagcactc
ttatactccgtttgggatttaaatgctattattgccatcgacgtattgggtgctgtgatt
gcatctattacggtagcaattgtacgtatacctaagctgggtaatcaagtgcaaagttta
gaaccaaatttcataagggagatgaaagaaggagttgtggttctgagacaaaacaaagga
ttgtttgccttattactcttaggaacactatatacttttgtttatatgccaatcaatgca
ctatttcctttaataagcatggaacactttaatggaacgcctgtgcatatttctattacg
gaaatttcctttgcatttgggatgctagcaggaggcttattattaggaagattagggggc
ttcgaaaagcatgtattactaataacaagttcattttttataatggggaccagtttagcc
gtttcgggaatacttcctccaaatggatttgtaatattcgtagtttgctgtgcaataatg
gggctttcggtgccattttatagcggtgtgcaaacagctctttttcaggagaaaattaag
cctgaatatttaggacgtgtattttctttgatcggaagtatcatgtcacttgctatgcca
attgggttaattctttctggattctttgctgataaaatcggtgtaaatcattggttttta
ctatcaggtattttaattattggcattgctatagtttgccaaatgataactgaggttaga
aaattagatttaaaataa

DBGET integrated database retrieval system