KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12215
Entry
HMPREF0837_12215  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: Imm44
Other DBs
NCBI-ProteinID: ADI70443
UniProt: D6ZP97
Position
complement(2026801..2026986)
AA seq 61 aa
MRECKMKYFEVELENPDEFLKLQTEDFVKANRLLLRKIIQSVTVYEENFVISFKSGIELE
V
NT seq 186 nt   +upstreamnt  +downstreamnt
atgagggaatgtaaaatgaaatattttgaggttgagttagaaaatcctgatgaattttta
aaactacaaacagaagattttgtgaaagctaatcgcttgctactaaggaagataatccag
agcgttacagtctatgaagaaaacttcgtcatatcctttaaatctggcatcgaattggaa
gtatga

DBGET integrated database retrieval system