KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12216
Entry
HMPREF0837_12216  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: Cys_rich_KTR Zn_ribbon_SprT Elf1 Zn_Tnp_IS1595 zf-TFIIB Nudix_N_2 NOB1_Zn_bind zf-IS66 DUF5679 DZR OrfB_Zn_ribbon DNA_ligase_ZBD Prim_Zn_Ribbon zf-NADH-PPase Lar_restr_allev HypA MCM_OB zf-H2C2_2 TF_Zn_Ribbon Auto_anti-p27
Other DBs
NCBI-ProteinID: ADI70444
UniProt: D6ZP98
Position
2027493..2027684
AA seq 63 aa
MTSKLTASTCPVCGNKTRLKIREDTELKKFPLYCPKCRQENLIEIKQFKVTVITEPDAKT
QSR
NT seq 192 nt   +upstreamnt  +downstreamnt
ttgactagcaaacttaccgcctcaacatgtcctgtatgtggaaataaaacacgattaaag
ataagggaagatactgaattaaaaaaattccccctctattgtccgaaatgcagacaagaa
aatttaattgaaataaagcagttcaaagtaactgtgattacagagccagacgcaaagacg
cagagccgataa

DBGET integrated database retrieval system