KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12218
Entry
HMPREF0837_12218  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Other DBs
NCBI-ProteinID: ADI70446
UniProt: D6ZPA0
Position
2028227..2028373
AA seq 48 aa
MVVLFTLLKYCILLPNGGLLEVNVAMKYIIYNKFPYIGFLSKKVVYLQ
NT seq 147 nt   +upstreamnt  +downstreamnt
atggtagtgctatttacgctgttaaaatattgtatattacttccaaatggcggtttgttg
gaggtcaacgtcgccatgaagtacatcatatacaataaatttccttacattgggttcttg
tcaaaaaaagtcgtctatctgcaatag

DBGET integrated database retrieval system