KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12219
Entry
HMPREF0837_12219  CDS       T01259                                 

Definition
(GenBank) RNA polymerase sigma factor, sigma-70 family
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: Sigma70_r4_2 Sigma70_r4 UPF0122 HTH_23 HTH_17 HTH_5 HTH_38 HTH_IclR HTH_28 DUF1492 HTH_54 Terminase_5 HTH_7
Other DBs
NCBI-ProteinID: ADI70447
UniProt: D6ZPA1
Position
2028602..2029024
AA seq 140 aa
MKPSSFQTTIENQFDYICKRAMEDERKNYMLYLSRIAKREVSFSDVGDYLVSQFATTDNY
STDFQIFTLNGLSVGVENDLLSEALRELPDKKREILLLFYFMDMSDSEIADLLKLNRSTV
YRHRTSGLALIKKFMEEFEE
NT seq 423 nt   +upstreamnt  +downstreamnt
atgaaaccatcttcttttcagaccacaatagaaaatcagtttgactatatctgtaaacgt
gctatggaagacgagcgaaagaattatatgctttatctttcaaggattgcaaagcgtgag
gtgtccttttcggatgttggcgattatcttgttagccagtttgcgacaacagataactat
tcaactgactttcagatttttacactcaatgggttatcagtaggcgttgaaaatgatttg
ttgagtgaagcattacgtgagttgccagacaagaaacgtgaaattctactgctgttttac
tttatggacatgagcgattcagaaattgcagacctgttgaaattgaaccgttctactgtc
tatcggcatagaaccagtggactagccttaattaaaaagtttatggaggaatttgaagaa
tga

DBGET integrated database retrieval system