KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12220
Entry
HMPREF0837_12220  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: HTH_16 DUF3943
Other DBs
NCBI-ProteinID: ADI70448
UniProt: D6ZPA2
Position
2029021..2029251
AA seq 76 aa
MKTQYPMIPFPLIVKATDGDTEAINQILHHYRGYITKRSLRLMKDEYGNQSMVVDEVLRG
RMETRLITKILSFEIK
NT seq 231 nt   +upstreamnt  +downstreamnt
atgaaaacacaatatcctatgattccctttcctctcattgtaaaggcaacagatggcgat
accgaagcgattaaccagattctacatcattacagagggtacataacgaagcgttcccta
cgacttatgaaagatgaatatggcaatcaaagtatggtcgttgatgaagtcttacgtgga
agaatggaaaccagactgattacaaagattttgtcatttgaaattaagtaa

DBGET integrated database retrieval system