KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12221
Entry
HMPREF0837_12221  CDS       T01259                                 

Definition
(GenBank) DNA binding domain, excisionase family
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: Tn916-Xis HTH_17 RelB_N RWP-RK
Other DBs
NCBI-ProteinID: ADI70449
UniProt: D6ZPA3
Position
2029712..2029915
AA seq 67 aa
MKQTDIPIWERYTLTIEEASKYFRIGENKLRRLAEENKNANWLIMNGNRIQIKRKQFEKI
IDTLDAI
NT seq 204 nt   +upstreamnt  +downstreamnt
atgaagcagactgacattcctatttgggaacgttataccctaaccattgaagaagcgtca
aaatattttcgtattggcgaaaacaagctacgacgcttggcagaggaaaataaaaatgca
aattggctgattatgaatggcaatcgtattcagattaaacgaaaacaatttgaaaaaatt
atagatacattggacgcaatctag

DBGET integrated database retrieval system