KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12222
Entry
HMPREF0837_12222  CDS       T01259                                 

Definition
(GenBank) site-specific recombinase, phage integrase family
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: Phage_integrase Integrase_DNA Phage_int_SAM_5 Syntaxin_2
Other DBs
NCBI-ProteinID: ADI70450
UniProt: D6ZPA4
Position
2029997..2031214
AA seq 405 aa
MSEKRRDNKGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISL
REKIAELQKDIHDGIDVVGKKMTLCQLYAKQNAQRPKVRKNTETGRKYLMDILKKDKLGV
RSIDSIKPSDAKEWAIRMSENGYAYQTINNYKRSLKASFYIAIQDDCVRKNPFDFQLKAV
LDDDTVPKTVLTEEQEEKLLAFAKADKTYSKNYDEILILLKTGLRISEFGGLTLPDLDFE
NRLVNIDHQLLRDTEIGYYIETPKTKSGERQVPMVEEAYQAFKRVLANRKNDKRVEIDGY
SDFLFLNRKNYPKVASDYNGMMKGLVKKYNKYNEDKLPHITPHSLRHTFCTNYANAGMNP
KALQYIMGHANIAMTLNYYAHATFDSAMAEMKRLNKEKQQERLVA
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgtcagaaaaaagacgtgacaataaaggtcgaatcttaaagactggagagagccaacga
aaagacggaagatacttatacaaatatatagattcatttggagaaccgcaatttgtttac
tcgtggaaacttgtggctacagaccgagtaccagcaggaaagcgtgattgtatctcactt
agagagaaaatcgcagagttacagaaagacattcatgatggtattgatgttgtaggaaag
aaaatgacactctgccagctttacgcaaaacagaacgctcaaagaccaaaggttagaaaa
aacactgaaactggacgcaaatatcttatggatattttgaagaaagacaagttaggtgta
agaagtattgacagtattaagccatcagacgctaaagaatgggctattagaatgagtgaa
aatggttatgcttatcaaaccatcaataactacaaacgttctttaaaggcttcattctat
attgctatacaagatgattgtgttcggaagaatccatttgactttcaactgaaagcagtt
cttgatgatgatactgtccctaagaccgtactaacagaagaacaggaagaaaaactgtta
gcctttgcaaaagctgataaaacctacagcaaaaattatgatgaaattctgatactctta
aaaacaggtcttcgtatttcagagtttggtggtttgacacttccagatttagattttgag
aatcgtcttgtcaatatagaccatcagctattgagagatactgaaattgggtactacatt
gaaacaccaaagaccaaaagtggcgaacgtcaagttcctatggttgaagaagcctatcaa
gcatttaagcgagtgttagcgaatcgaaagaatgataagcgtgttgagattgatggatat
agtgatttcctctttcttaatagaaagaactatccaaaagtggcaagtgattacaacggc
atgatgaaaggtcttgttaagaaatacaataagtataacgaggataaattgccacacatc
actccacatagtttgcgacatacattctgtaccaactatgcaaatgcaggaatgaatcca
aaggcattacagtacattatgggacatgctaatatagccatgacgctgaactattacgca
catgcaacattcgattctgcaatggcagaaatgaaacgcttgaataaagagaagcaacag
gagcgtcttgttgcttag

DBGET integrated database retrieval system