KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12223
Entry
HMPREF0837_12223  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Other DBs
NCBI-ProteinID: ADI70451
UniProt: D6ZPA5
Position
2031564..2031704
AA seq 46 aa
MIEVLERCCFSIEIIEKKWEKFAIFTEKGRKSIEISQMEMFDKMLS
NT seq 141 nt   +upstreamnt  +downstreamnt
atgattgaagttctggaaagatgttgtttcagtattgaaatcattgagaaaaagtgggaa
aaatttgcgattttcacagagaaaggaagaaaaagtatagaaataagtcaaatggagatg
tttgataaaatgctttcatag

DBGET integrated database retrieval system