KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12224
Entry
HMPREF0837_12224  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Other DBs
NCBI-ProteinID: ADI70452
UniProt: D6ZPA6
Position
2031882..2031989
AA seq 35 aa
MAFSLALPVLVASHRGGEWTYGGYHDPNNWGANYI
NT seq 108 nt   +upstreamnt  +downstreamnt
ttggcatttagtttggctcttcctgttttggtagcttctcaccgtggtggcgagtggacc
tatggaggctatcatgatccaaataattggggagcaaattacatttga

DBGET integrated database retrieval system