KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12225
Entry
HMPREF0837_12225  CDS       T01259                                 

Definition
(GenBank) bacteriocin-associated integral membrane protein
  KO
K02004  putative ABC transport system permease protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:snc02000]
    HMPREF0837_12225
Transporters [BR:snc02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    HMPREF0837_12225
SSDB
Motif
Pfam: DUF1430
Other DBs
NCBI-ProteinID: ADI70453
UniProt: D6ZPA7
Position
2032105..2034120
AA seq 671 aa
MKKLFILISNLLASLFFVWVFTIWTDTYVSYYYPNVVVRDSSPETTFQHVATRLEKLAEE
TDSFIAIQHQDPNSEGTPVFSYTTFGNGKLPDGLQEKNLEDAQSSSVETNYFVFDGNLDI
HLLREELSQLGLTNMHLTIPSKLSTLMAIFSNGFQLISLLIFILTFGALTLISQISQLRS
SGIRLISGEKRWFIFLRPVGEDLKGIAVGFSLAGVLTILMQKILSLPTQSLMTIGAGLLS
YNLILLSISLFFAQLFAVGIKKIHLMQIIKGQVPVRGIISLILIGQLLAIIIVTLGIGSS
LKYSQAWQQHRIGQEAWSQERQLITLSISREGTSPGFDEQAQRKLRTWYQLMDLAVSEQK
AFLSRHQLIDRTLQNGMASSKNFITSTEWYDYSPNGNVLIVTPQYLERQNIPVDTTIEQK
MNHLDVGEFVLLLPEHLRSEEDHYKSVFEDDLTSRMSSQDERQQMTATVGYLESGQDRFV
YNTTPISYQQFLKDPIIIVITPQSTGPQSILFWIDAVQNYVLFNQLSDAQELIQRQGIEN
WVSEMQTGYHNYITLLDNIQRERWVMLAGAVLGIATSILLFNTMNRLYFEEFRRAIFIKR
IAGLRFLEIHRTYLFAQLGVFLLGFVASVFLQVEIGVAFLVLLLFTGLSLLQLHVQMQKE
NKMSILVLKGG
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgaaaaaattatttatactcatatccaacctgcttgctagtttgttctttgtttgggta
tttaccatttggactgatacatatgtctcctattattaccccaacgttgttgtacgtgat
tcttcccctgaaacaacttttcagcatgttgctacacgcttggaaaaactagcagaagaa
acggatagctttattgcgattcaacaccaagatcctaactcagaaggtactccagtgttt
tcttatacgacctttgggaacggaaagttgcctgatgggcttcaggaaaaaaatctagaa
gatgctcaaagtagtagtgttgaaacaaactattttgtattcgatggaaacctagatatt
cacttgctaagggaggagctaagtcaacttggcttgactaacatgcacctgacaattcca
tctaaactatctacgttaatggctatctttagtaacggatttcagttaatcagtctattg
attttcatcttaacctttggagcactaactttaattagtcaaattagccaattacggtcg
tcgggcattcgcctcatttcaggagagaaacggtggttcatttttcttagaccagttggt
gaggatttgaaagggatagctgttggtttcagtttagctggcgtgctcaccattcttatg
caaaaaattctgtcgcttccaacgcaatccctaatgaccataggagcaggcttgctcagt
tataatctcatcttgttgtcgatctccctgtttttcgctcaactcttcgcagttgggata
aaaaagatacacctgatgcagattataaaagggcaagtgcctgtcagaggaatcattagt
ttgattttaatcggtcaactattagcgattattattgtaacgctgggaatagggagtagc
ttaaagtattcccaagcctggcaacagcatcggattggacaagaggcttggagccaggaa
aggcaactgattaccctatcaatcagccgtgaaggaacgagtcctggttttgatgaacaa
gctcaaaggaaactcagaacttggtatcaattgatggatctggctgtttcagaacaaaag
gctttcttatctagacaccagttaattgaccgtactttgcaaaatggtatggcttcctcc
aaaaactttataacctctacagaatggtacgattacagcccgaatggcaatgtccttatc
gtcacaccgcaatacttggagcgtcaaaacattcctgtagatacaactattgagcaaaag
atgaatcaccttgatgtaggggagtttgtcttattgctgcctgaacacctccgttcagag
gaagatcattataaatctgtttttgaagacgacttaaccagtcgcatgtctagtcaagat
gaacgacagcaaatgactgctacggtaggttatttagaatcaggtcaggatcgttttgtg
tataatacgacccctatttcttaccagcagtttttgaaagatccaatcatcattgttata
acaccccaatcaactggtccacagtccattttgttttggatagacgcagtacagaactac
gttctctttaatcaattgtctgatgcccaggagcttatccagagacaaggcattgaaaat
tgggtctcagaaatgcaaacaggttaccacaactacatcacattattggataatatccag
agggaacgttgggtaatgctagcaggagctgtgcttgggattgcaacttcaatcttgttg
tttaacactatgaataggctctactttgaagaatttagacgtgccatttttatcaaacgc
attgcaggtctcaggttcttagaaatccatcgcacttatctctttgctcaactgggtgtg
tttttactgggatttgttgcgagtgtatttcttcaggtagagataggagttgctttctta
gtcttgttactctttactggtctatctcttttacagttacatgtccaaatgcagaaagaa
aacaagatgtccattcttgttttgaagggaggttaa

DBGET integrated database retrieval system