KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12226
Entry
HMPREF0837_12226  CDS       T01259                                 

Definition
(GenBank) putative bacteriocin export ABC transporter, lactococcin 972 group
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:snc02000]
    HMPREF0837_12226
Transporters [BR:snc02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    HMPREF0837_12226
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_29 AAA_22 RsgA_GTPase AAA_15 TsaE AAA_24 ATPase_2 AAA_23 AAA_14 Zeta_toxin cobW NB-ARC AAA_30 AAA_25
Other DBs
NCBI-ProteinID: ADI70454
UniProt: D6ZPA8
Position
2034122..2034754
AA seq 210 aa
MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYR
GKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLTGQKLSRSEQRLRQKQALEQ
VGLAYLDLDKRIFELSGGESQRVALAKVILKNPPFILADEPTASIDPATSQLIMEILLSL
RDDNRLIIIATHNPAIWEMADEVFTMDHLK
NT seq 633 nt   +upstreamnt  +downstreamnt
atgattgaacttaaacaggtgagtaaatcttttggagaacgagagttattttcgaatctt
tcaatgacatttgaggctggaaaagtctatgccttaattggttcaagtggtagcggaaaa
acaaccttgatgaacatgattgggaaattagaaccttatgatgggacgattttttaccga
ggtaaagacttggccaattataaatcgagtgattttttccgtcacgaattgggttacctc
ttccagaactttggcttaattgaaaaccaaagtattgaagaaaaccttaagctaggtctc
actggtcaaaagttgagtcggtcggaacagcggttgaggcagaagcaggctttagaacag
gtcggcctggcttatcttgacctagataagcgcatctttgagttatcgggcggagaatcg
caacgggttgccttggcaaaagttatcttaaagaatccaccctttattctggcagatgag
ccaacagcttcaatagacccagcaacctctcagttgattatggagattttgctatctctt
cgagatgataataggctaatcattatcgcaacacataatccggcaatttgggagatggct
gatgaagtgttcacgatggatcatctgaaataa

DBGET integrated database retrieval system