KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12227
Entry
HMPREF0837_12227  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Other DBs
NCBI-ProteinID: ADI70455
UniProt: D6ZPA9
Position
2034895..2035056
AA seq 53 aa
MKKFDNYIIEKPCDSNSDKLQKILIIESLVDDILQFSLRINNSVGEIFLLQPF
NT seq 162 nt   +upstreamnt  +downstreamnt
atgaaaaaattcgacaattatattattgagaagccttgcgattctaattcagataaactg
caaaaaatcttaataattgaaagtttggtagatgatattttgcaattttctctcagaatc
aataatagtgtaggagagattttcctcctacaaccgttttaa

DBGET integrated database retrieval system