KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12228
Entry
HMPREF0837_12228  CDS       T01259                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00230  Purine metabolism
snc00240  Pyrimidine metabolism
snc01100  Metabolic pathways
snc01110  Biosynthesis of secondary metabolites
Module
snc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
snc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
snc_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HMPREF0837_12228
   00240 Pyrimidine metabolism
    HMPREF0837_12228
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:snc04131]
    HMPREF0837_12228
Enzymes [BR:snc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     HMPREF0837_12228
Membrane trafficking [BR:snc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    HMPREF0837_12228
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-ProteinID: ADI70456
UniProt: D6ZPB0
Position
complement(2035682..2036095)
AA seq 137 aa
MEQTFFIIKPDGVKRGLVGEVLKRIEQRGFTIEKLEFRSQVSEELIDQHYQDLVGQSFYP
PIREFMTSGPVLVGVISGPKVIETWRTMMGATRPEEALPGTIRGDFAKAAGENEIIQNVV
HGSDSEESAKREIALWF
NT seq 414 nt   +upstreamnt  +downstreamnt
atggaacaaacattctttatcatcaaaccagatggtgtaaaaagagggctagtgggtgaa
gtgttaaagcgcatcgaacaacgtggatttacaatcgaaaaattggagtttcgttcacag
gtttcagaagagttgattgaccagcactatcaggacttggttggtcagagtttttaccca
ccgattcgtgaattcatgacttcaggtccagttcttgtgggtgtcatttctggtcccaaa
gtaatcgaaacttggcggaccatgatgggtgcaactcgtccagaagaagctttaccaggc
actattcgaggtgattttgcaaaagctgctggagaaaatgagattatccaaaatgttgta
catggttcagattcagaagagtcagctaagcgagaaattgctctttggttttaa

DBGET integrated database retrieval system