KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12229
Entry
HMPREF0837_12229  CDS       T01259                                 

Gene name
rpoC
Definition
(GenBank) DNA-directed RNA polymerase, beta' subunit
  KO
K03046  DNA-directed RNA polymerase subunit beta' [EC:2.7.7.6]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:snc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    HMPREF0837_12229 (rpoC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:snc03021]
    HMPREF0837_12229 (rpoC)
   03400 DNA repair and recombination proteins [BR:snc03400]
    HMPREF0837_12229 (rpoC)
Enzymes [BR:snc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     HMPREF0837_12229 (rpoC)
Transcription machinery [BR:snc03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     HMPREF0837_12229 (rpoC)
DNA repair and recombination proteins [BR:snc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      HMPREF0837_12229 (rpoC)
SSDB
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4
Other DBs
NCBI-ProteinID: ADI70457
UniProt: D6ZPB1
Position
complement(2036206..2039856)
AA seq 1216 aa
MQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIR
YRGIVCDRCGVEVTRTKVRRERMGHIELKAPVSHIWYFKGIPSRMGLTLDMSPRALEEVI
YFAAYVVIDPKDTPLEHKSIMTEREYRERLREYGYGSFVAKMGAEAIQDLLKQVDLEKEI
AELKEELKTATGQKRVKAIRRLDVLDAFYKSGNKPEWMILNILPVIPPDLRPMLQLDGGR
FASSDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGP
GSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKP
FVMREIVARDIVQNVKAAKRLVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEP
VLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARILMLAAEHILNPKDGKPV
VTPSQDMVLGNYYLTMEEAGREGEGMVFKDRDEAVMAYRNGYVHLHSRVGIATDSLNKPW
TEEQRHKVLLTTVGKILFNDIMPEGLPYLQEPNNANLTEGVPAKYFLPLGGDIKEAISNL
ELNPPFKKKNLGNIIAEIFKRFRTTETSALLDRMKNLGYHHSTLAGLTVGIADIPVVDDK
AEIIEESHKRVEQITKQFRRGMITDDERYNAVTAEWRAAREKLEKRLIANQDPKNPIVMM
MDSGARGNISNFSQLAGMRGLMAAPNGRIMELPILSNFREGLSVLEMFFSTHGARKGMTD
TALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRSIAEGKEMIESLEERLNGRYTK
KTVKHPETGAVIIGPNELITEDKAREIVNAGVEEVTIRSVFTCNTRHGVCRHCYGINLAT
GDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRVQEIFEARNPKGE
AVITEVKGQVTAIEEDASTRTKKVFVKGETGEGEYVVPFTARMRVEVGGQVARGAALTEG
SIQPKRLLAVRDVLSVETYLLGEVQKVYRSQGVEIGDKHIEVMVRQMIRKVRVMDPGDTD
LLMGTLMDINDFTDANKDVLIAGGVPATGRPVLMGITKASLETNSFLSAASFQETTRVLT
DAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNLEPHAVNEEEYLNPPVEEEGNEETT
EVVVDTAVETVEETVE
NT seq 3651 nt   +upstreamnt  +downstreamnt
atgcaaatcaccctagcttctccaagtaaagtccgttcatggtcttatggagaagtcaaa
aaacctgaaacaatcaattaccgtaccttgaaaccagaacgtgaaggactctttgatgaa
gtgatctttggtcctacaaaagactgggaatgtgcttgtggtaagtacaaacgcattcgt
tacagaggaattgtttgtgaccgctgtggggttgaagtaacgcgtacgaaagttcgtcgt
gagcgtatgggacatatcgaattgaaagctcctgtatctcacatctggtacttcaagggg
attccaagccgtatgggcttgacccttgatatgagccctcgtgccctcgaggaagttatc
tactttgcggcttatgtggtgattgatcctaaggatacaccacttgagcacaagtctatc
atgacagagcgcgaataccgagagcgcttgcgtgaatatggttatggttcatttgttgcc
aagatgggtgcggaagccatccaagaccttttgaagcaagtagatcttgaaaaagaaatt
gctgaactcaaagaagaattgaaaacagctactggacaaaaacgtgtcaaagccatccgt
cgtttggatgttttggatgccttttacaagtctggaaacaaacctgaatggatgattctt
aacatccttccggttattccaccagatcttcgtccaatgttgcagttggatggtggccgt
tttgcctcatctgacttgaatgacctttaccgccgtgttatcaaccgtaacaaccgtttg
gctcgtttgcttgagttaaatgcaccaggtatcatcgttcaaaatgagaagcgtatgctt
caagaagcagttgacgctttgattgacaatggtcgccgtggtcgtccaatcacaggacca
ggtagccgtccattgaaatcattgagccacatgcttaaaggtaaacaaggacgcttccgt
caaaacttgctcggtaaacgtgttgacttttcaggacgttccgttatcgctgttggtcca
actcttaagatgtaccaatgtggtgtgccacgtgaaatggcgattgaactctttaaacca
tttgtcatgcgtgaaatcgttgcccgtgatatcgtgcaaaacgtcaaagcagctaaacgc
ttggtggaacgcggagatgagcgtatctgggatatccttgaagaagtgattaaagaacac
ccagtgcttttgaaccgcgcaccgacccttcaccgtttgggtatccaagccttcgagcca
gtcttgattgatggtaaggctcttcgcttgcacccacttgtctgtgaagcctacaatgct
gactttgacggggaccaaatggccatccacgtaccactttcagaagaagcacaagcagaa
gctcgtatcctcatgctagctgctgagcacatcttgaacccgaaagatgggaaaccggta
gttactccatctcaggacatggttttgggtaactactacttgaccatggaagaagctggt
cgcgaaggtgaaggaatggtcttcaaagaccgtgacgaagcggttatggcttaccgcaat
ggctatgttcacctccactcacgtgttggtatcgcaacagacagcctcaacaagccttgg
acagaagagcaaagacataaggtcttgcttacaacagttggtaaaattctcttcaacgat
atcatgccagaggggctaccatacttgcaagaaccaaacaatgccaacttgacagaaggt
gttccagctaaatacttcttgccacttggtggagatatcaaggaagctatcagcaatctt
gagctcaaccctccattcaagaaaaaaaaccttggaaatatcatcgctgaaatcttcaaa
cgtttccgtacgacagaaacttctgccctacttgaccgcatgaagaatctcggttaccac
cactcaactcttgcaggattgacagtgggtattgccgacatcccagtcgttgatgacaag
gctgaaatcattgaagaatcacacaaacgtgtcgaacaaatcaccaaacaattccgtcgt
ggtatgatcacagacgacgagcgttacaatgctgttacagctgaatggcgtgctgcccgt
gaaaaacttgagaaacgcttgattgctaaccaagatcctaagaacccaatcgttatgatg
atggactctggagcccgtggtaacatctcaaacttctcacagcttgccggtatgcgtggt
ctgatggctgctccgaatggacgtatcatggaattgccaattctttcaaacttccgcgaa
ggtttgtcggtattggaaatgttcttctcaactcacggtgctcgtaaaggtatgaccgat
acggcccttaagacagccgactcaggttacttgactcgtcgtttggtcgacgttgcccaa
gacgttatcatccgtgaggacgactgtggaactgaccgtggtctcttgatccgttctatc
gcagaaggaaaagagatgatcgagtctctcgaagagcgtctcaacggtcgttacactaag
aaaactgttaaacatccagaaactggtgcagtgattattggtccaaatgaattgattaca
gaagacaaggcgcgtgaaattgtcaatgctggtgtggaagaagtgactatccgttctgta
tttacatgtaacactcgtcacggtgtctgccgtcactgttatggtatcaacttggcgact
ggtgatgcggttgaagttggtgaagcagttggtacaatcgctgcccaatctatcggggaa
cctggtacacagcttacaatgcgtaccttccacacaggtggggttgcctcaaataccgat
atcactcagggtcttcctcgtgtccaagaaatctttgaagcccgcaatcctaaaggggaa
gcggttataacagaggttaaaggacaagttactgctatcgaagaagatgcatcaactcgt
accaagaaagtctttgttaagggtgaaactggcgaaggtgaatatgtcgttccatttaca
gctcgtatgcgtgtcgaagttgggggccaagtagcgcgtggtgctgctctgacagaaggt
tctatccaaccaaaacgtctccttgcagttcgtgatgtcttgtcagttgaaacgtacctt
ctcggtgaagtacaaaaagtttaccgtagccaaggggtagaaatcggtgacaaacacatc
gaggtaatggttcgtcaaatgatccgtaaagtccgtgtcatggatccaggtgatacagat
cttctcatgggtaccctcatggatatcaatgactttacagatgccaacaaagatgtcctt
atcgcaggtggagttccagcgacaggtcgcccagtccttatgggaattaccaaagcctca
cttgaaacaaacagtttcttgtcagcggcttccttccaggaaacaactcgtgtccttact
gacgcagctatccgtggtaagaaagaccatctccttggacttaaagaaaatgttatcatc
ggtaagatcatcccagctggtactggtatggcccgttaccgtaaccttgaaccacatgct
gtcaacgaagaagaataccttaatcctccagtagaggaagaaggaaatgaagaaacaaca
gaagtagttgtggatactgccgttgaaactgtggaagaaacagtagaataa

DBGET integrated database retrieval system