KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12231
Entry
HMPREF0837_12231  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
  KO
K03699  putative hemolysin
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:snc02042]
    HMPREF0837_12231
Bacterial toxins [BR:snc02042]
 Type II toxins: Membrane damaging toxins
  Pore-forming toxins, Other
   HMPREF0837_12231
SSDB
Motif
Pfam: DUF21 CorC_HlyC CBS
Other DBs
NCBI-ProteinID: ADI70459
UniProt: D6ZPB3
Position
complement(2044211..2045542)
AA seq 443 aa
MEDPSSQNLLLQFVLLFILTVLNAFFSATEMAMVSLNRARVEQKAEEGDRRYIRLLKVLE
NPNHFLSTIQVGITLITILSGASLTDTLGRVIASWLGNGETAQAVATFLSLAFLTYISIV
FGELYPKRIALNLKDALAIRTAPIIIGIGKLVSPFVWLLAASTNFLSHLTPMSFDDADEK
MTRDEIAYMLTNSEETLDADEIEMLQGVFSLDELMAREVMVPRTDAFMVDIQDDSQAIIQ
SILKQNYSRIPVYDGDKDNVIGIIHTKSLLKAGFVDGFDNIVWKRILQDPLFVPETIFVD
DLLKELRNTQRQMAILLDEYGGMAGLVTLEDLLEEIVGEIDDETDKAAIDVHQIGEDTYI
VQGTMTLNDFNNYFDVELESDDVDTIAGYYLTGVGTIPTTEKLSYELVSQNKQFILTNDK
VKNGRVTKVKVQITEVEIEEETE
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggaagacccaagtagtcagaatttgttgctacaatttgttttattgtttatcttgacg
gtattaaatgcctttttctcagccacagaaatggccatggtttctcttaatcgtgcccga
gttgaacaaaaggcggaagaaggagacagacgctacatccgcctgctgaaggtactagaa
aatcctaaccactttttatcaaccattcaggtaggaatcaccctgattacaatcttatca
ggggcgagtttaactgatactctaggacgtgtgattgcctcttggcttgggaatggcgaa
acagcacaagccgtggcaacttttctatccttggcatttttgacctatatttccatcgtt
tttggggaattatatcctaagagaatcgctcttaatctaaaggatgccttggcaattcgt
acagcgccgattatcattgggatcggaaaactagtcagtccttttgtttggcttttagct
gcttcgaccaatttcttgagccatttgactcctatgtcattcgatgatgcggatgaaaag
atgacccgtgatgaaattgcctatatgctgacaaatagtgaagaaacattggatgctgat
gagattgagatgctacaaggtgtcttttcgctcgatgaactgatggcacgagaggttatg
gtgcctcgaacggatgcctttatggtggatattcaggatgatagtcaagccattatccaa
agtattttaaaacaaaattattctcgtatcccggtttatgatggggataaggacaatgta
attggaatcattcacaccaagagtctccttaaggcaggctttgtggacggttttgacaat
attgtttggaagagaattttacaagatccactttttgtacctgaaactatttttgtggat
gacttgctaaaagaactgcgaaatacccaaagacaaatggcaatcttgctggatgaatac
ggtggtatggctggtttggtgactttggaagacctcttagaggaaattgttggtgaaatt
gatgatgaaacggacaaagcagcaatagatgttcatcagattggcgaggatacctacatt
gttcaaggaactatgaccctcaatgatttcaataattactttgatgttgaactggaaagt
gatgacgttgataccatcgctggttattatttgacaggagtgggaactattccaacgact
gagaaactcagctatgaattggtcagccaaaacaaacagtttatcttaaccaatgataaa
gtgaagaatggacgtgttaccaaggtaaaagtccaaatcacagaagtcgaaatagaagaa
gaaacagaataa

DBGET integrated database retrieval system