KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12232
Entry
HMPREF0837_12232  CDS       T01259                                 

Definition
(GenBank) DNA/RNA non-specific endonuclease
  KO
K15051  DNA-entry nuclease
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99984 Nucleotide metabolism
    HMPREF0837_12232
SSDB
Motif
Pfam: Endonuclease_NS Endonuclea_NS_2 SDH_beta
Other DBs
NCBI-ProteinID: ADI70460
UniProt: D6ZPB4
Structure
PDB: 
3OWV

Position
complement(2045833..2046657)
AA seq 274 aa
MNKKTRQTLIGLLVLLLLSTGSYYIKQMQSAPNSPKTNLSQKKQAPEAPSQALAESVLTD
AVKSQIKGSLEWNGSGAFIVNGNKTNLDAKVSSKPYADNKTKTVGKETVPTVANALLSNA
TRQYKNRKETGNGSTSWTPPGWHQVKNLKGSYTHAVDRGHLLGYALIGGLDGFDASTSNP
KNIAVQTAWANQAQAEYSTGQNYYESKVRKALDQNKRVRYRVTLYYASNEDLVPSASQIE
AKSSDGELEFNVLVPNVQKGLQLDYRTGEVTVTQ
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaacaaaaaaacaagacagacactaatcggactgctagtgttattgcttttgtctaca
gggagctattatatcaagcagatgcagtcggcacctaatagtcccaaaaccaatcttagt
cagaaaaaacaagcgcctgaagctcctagtcaagcattggcagagagtgtcttaacagac
gcagtcaagagtcaaataaaggggagtctggagtggaatggctcaggtgcttttatcgtc
aatggtaataaaacaaatctagatgccaaggtttcaagtaagccctacgctgacaataaa
acaaagacagtgggcaaggaaactgttccaaccgtagctaatgccctcttgtctaatgcc
actcgtcagtacaagaatcgtaaagaaactgggaatggttcaacttcttggactcctcca
ggttggcatcaggtcaagaatctaaagggctcttatacccatgcagtcgatagaggtcat
ttgttaggctatgccttaatcggtggtttggatggttttgatgcctcaacaagcaatcct
aaaaacattgctgttcagacagcctgggcaaatcaggcacaagccgagtattcgactggt
caaaactactatgaaagcaaggtgcgtaaagccttggaccaaaacaagcgtgtccgttac
cgtgtaaccctttactacgcttcaaacgaggatttagttccctcagcttcacagattgaa
gccaagtcttcggatggagaattggaattcaatgttctagttcccaatgttcaaaaggga
cttcaactggattaccgaactggagaagtaactgtaactcagtaa

DBGET integrated database retrieval system