KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12234
Entry
HMPREF0837_12234  CDS       T01259                                 

Gene name
murA
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00520  Amino sugar and nucleotide sugar metabolism
snc00550  Peptidoglycan biosynthesis
snc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0837_12234 (murA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF0837_12234 (murA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:snc01011]
    HMPREF0837_12234 (murA)
Enzymes [BR:snc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     HMPREF0837_12234 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:snc01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   HMPREF0837_12234 (murA)
SSDB
Motif
Pfam: EPSP_synthase
Other DBs
NCBI-ProteinID: ADI70462
UniProt: D6ZPB6
Structure
PDB: 
6NKJ 5WI5

Position
complement(2046877..2048160)
AA seq 427 aa
MDKIVVQGGDNRLVGSVTIEGAKNAVLPLLAATILASEGKTVLQNVPILSDVFIMNQVVG
GLNAKVDFDEEAHLVKVDATGDITEEAPYKYVSKMRASIVVLGPILARVGHAKVSMPGGC
TIGSRPIDLHLKGLEAMGVKISQTAGYIEAKAERLHGAHIYMDFPSVGATQNLMMAATLA
DGVTVIENAAREPEIVDLAILLNEMGAKVKGAGTETITITGVEKLHGTTHNVVQDRIEAG
TFMVAAAMTGGDVLIRDAVWEHNRPLIAKLLEMGVEVIEEDEGIRVRSQLENLKAVHVKT
LPHPGFPTDMQAQFTALMTVAKGESTMVETVFENRFQHLEEMRRMGLHSEIIRDTARIVG
GQPLQGAEVLSTDLRASAALILTGLVAQGETVVGKLVHLDRGYYGFHEKLAQLGAKIQRI
EASDEDE
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggataaaattgtggttcaaggtggcgataatcgtctggtaggaagcgtgacgatcgag
ggagcaaaaaatgcagtcttacccttgttggcagcgactattctagcaagtgaaggaaag
accgtcttgcagaatgttccgattttgtcggatgtctttattatgaatcaggtagttggt
ggtttgaatgccaaggttgactttgatgaggaagctcatcttgtcaaggtggatgctact
ggcgacatcactgaggaagccccttacaagtatgtcagtaagatgcgcgcctccatcgtt
gtattagggccaatccttgcccgtgtgggtcatgccaaggtatccatgccaggtggttgt
acgattggtagccgtcctattgatcttcatttgaaaggtctggaagctatgggggttaag
attagtcagacagctggttacatcgaagcaaaggcagaacgcttgcatggtgctcatatc
tatatggactttccaagtgttggtgcaacgcagaacttgatgatggcagcgactctggct
gatggggtgacagtgattgagaatgctgcgcgtgagcctgagattgttgacttagccatt
ctccttaatgaaatgggagccaaggtcaaaggtgctggtacagagactataaccattact
ggtgttgagaaacttcatggtacgactcacaatgtagtccaggaccgtatcgaagcagga
acctttatggtagctgctgccatgactggtggtgatgtcttgattcgagacgctgtctgg
gagcacaaccgtcccttgattgccaagttacttgaaatgggtgttgaagtaattgaagaa
gacgaaggaattcgtgttcgttctcaactagaaaatctaaaagctgttcatgtgaaaacc
ttgccccacccaggatttccaacagatatgcaggctcaatttacagccttgatgacagtt
gcaaaaggcgaatcaaccatggtggagacagttttcgaaaatcgtttccaacacctagaa
gagatgcgccgcatgggcttgcattctgagattatccgtgatacagctcgtattgttggt
ggacagcctttgcagggagcagaagttctttcaactgaccttcgtgccagtgcagccttg
attttgacaggtttggtagcacagggagaaactgtggtcggtaaattggttcacttggat
agaggttactacggtttccatgagaagttggctcagctaggtgctaagattcagcggatt
gaggcaagtgatgaagatgaataa

DBGET integrated database retrieval system