KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12236
Entry
HMPREF0837_12236  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
  KO
K07177  Lon-like protease
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:snc01002]
    HMPREF0837_12236
Peptidases and inhibitors [BR:snc01002]
 Serine peptidases
  Family S16: lon protease family
   HMPREF0837_12236
SSDB
Motif
Pfam: PDZ_2 Lon_C AOC_like
Other DBs
NCBI-ProteinID: ADI70464
UniProt: D6ZPB8
Position
complement(2048472..2049509)
AA seq 345 aa
MKKKIRWPLYVIAALIVTFLAFVVPLPYYIEVPGGSEDIRQVLKVNDTEDKEAGAYQFVT
VGVQHATLAHMIYAWLTPFTDIRSAQETTGGSSDVEFMRINQFYMQTSQNMAKYQGLKTA
GKDIELKYFGVYVLNVTDNSTFKGILNISDTVTAVNDQTFDSSKDLIDYVSSQKLGDSVK
VTYEEDGQTKSAEGKIITLENGKNGIGIGLIDRTEVISNVPISFSTAGIGGPSAGLMFSL
AIYTQIAHPDLRNGRIVAGTGTIDRDGNVGDIGGIDKKVVASARAGAAIFFTPDNPVSEE
EQKAHPDAKNNYQTALEAAKTIKTDMKIVPVKTLQDAIDYLKNNP
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgaaaaaaaagattagatggcccttatacgtcattgcggccttgattgtgactttcttg
gcatttgtagtgcccttgccttattatatagaggttccaggtggttcggaagatattcgc
caagtccttaaagtaaatgacacagaagataaggaagctggtgcctatcaattcgttacg
gttggtgttcaacatgccactttagctcatatgatttatgcttggttgacaccttttaca
gatattcgtagtgctcaggagactacaggtggttcttccgatgttgaatttatgcgaatc
aatcaattctacatgcaaacatcgcaaaatatggccaagtatcaaggactaaaaacagct
ggtaaggatatcgaactcaagtactttggagtttatgttttgaatgtgacggataattca
acctttaaagggattctcaatatctctgatacagtcacagcagtcaatgatcagaccttt
gatagttccaaagacttgattgattacgtcagttctcaaaaattaggggattccgtcaag
gtcacctatgaagaggatgggcaaaccaagtctgcagaaggaaaaatcatcaccttggaa
aatggcaaaaatggaattggaatcggcttgattgaccgtacagaggtaatcagcaatgtc
ccaattagcttttcaacagctggtattggcggtccaagtgctggtctcatgtttagtcta
gctatctatactcaaatagctcacccagatcttcgtaatggtcgtattgttgccggtaca
ggtaccattgaccgcgatggtaatgtgggagacattggaggtattgataagaaggttgta
gcttcggctagggcaggtgctgctattttctttactcctgataaccctgttagcgaagaa
gaacaaaaggcgcatccggacgcgaaaaacaactaccaaacagccctagaagcggctaaa
acaatcaagacggatatgaaaatcgtgcccgttaaaaccctacaagatgcgattgattac
ttgaaaaacaatccctaa

DBGET integrated database retrieval system