KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12237
Entry
HMPREF0837_12237  CDS       T01259                                 

Gene name
coaD
Definition
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00770  Pantothenate and CoA biosynthesis
snc01100  Metabolic pathways
Module
snc_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    HMPREF0837_12237 (coaD)
Enzymes [BR:snc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     HMPREF0837_12237 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig Pantoate_ligase
Other DBs
NCBI-ProteinID: ADI70465
UniProt: D6ZPB9
Position
complement(2049493..2049981)
AA seq 162 aa
MSDKIGLFTGSFDPMTNGHLDMIERASRLFDKLYVGIFFNPHKQGFLPLENRKRGLEKAV
KHLGNVKVVSSHDELVVDVAKRLGATCLVRGLRNASDLQYEASFDYYNHQLSSDIETIYL
HSRPEHLYISSSGVRELLKFGQDIACYVPESILEEIRNEKKD
NT seq 489 nt   +upstreamnt  +downstreamnt
atgtcagataagattggcttattcacaggctcatttgatccgatgacaaatgggcatctg
gatatgattgaacgggcgagcagactctttgataagctttatgtgggtattttttttaat
ccccacaaacaaggatttctccctcttgaaaatcgtaaacgggggttagaaaaggctgtg
aaacatttgggaaatgttaaagtcgtgtcttctcatgatgaattggtggtcgatgttgca
aaaagattgggtgctacttgtctagtgcgaggcttgagaaatgcgtcggatttgcaatat
gaagccagttttgattactacaatcatcagctgtcttctgatatagagactatttattta
catagtcgacctgaacatctctatatcagttcatcaggcgttagagagcttttgaagttt
ggtcaggatattgcctgctatgttcccgagagtattttggaggaaataagaaatgaaaaa
aaagattag

DBGET integrated database retrieval system