KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12238
Entry
HMPREF0837_12238  CDS       T01259                                 

Definition
(GenBank) RNA methyltransferase, RsmD family
  KO
K08316  16S rRNA (guanine966-N2)-methyltransferase [EC:2.1.1.171]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:snc03009]
    HMPREF0837_12238
Enzymes [BR:snc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.171  16S rRNA (guanine966-N2)-methyltransferase
     HMPREF0837_12238
Ribosome biogenesis [BR:snc03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    HMPREF0837_12238
SSDB
Motif
Pfam: Cons_hypoth95 MTS Methyltransf_24 Methyltransf_25 N6-adenineMlase MethyltransfD12 Methyltransf_31 PrmA Methyltrans_SAM RsmJ UPF0020 Met_10 Methyltransf_15 TRM Methyltransf_30 SAM_MT DNA_methylase
Other DBs
NCBI-ProteinID: ADI70466
UniProt: D6ZPC0
Position
complement(2049971..2050510)
AA seq 179 aa
MKIVSGIYGGRPLKTLEGKTTRPTSDKVRGAIFNMIGPYFEGGRVLDLYAGSGGLSIEAV
SRGMSSAVLVERDRKAQTIVAENIQMTKEVGKFQLLKMDAERALEQVSGEFDLVFLDPPY
AKEQIVADIEKMAERELFSEDVMVVCETDKAVELPEEIACLGIWKEKIYGISKVTVYVR
NT seq 540 nt   +upstreamnt  +downstreamnt
atgaaaatcgtatcaggaatctatgggggacgtcccctcaagacactagaaggcaagacg
acaagacctacttcggataaggttaggggagccatttttaacatgattggtccctacttt
gaagggggacgagtcttggacctttatgcaggtagtggtggtttatctatcgaagcagta
tcgcgtggcatgtccagtgctgttttggtggagcgagaccgtaaggctcagaccatcgtg
gctgaaaatatccagatgaccaaggaagttggaaaatttcaactcctcaagatggatgca
gagagggcattggaacaggtatctggggaatttgacctcgttttcttagaccctccctat
gccaaggaacaaatcgtagcagatattgaaaaaatggctgagagagagcttttttctgaa
gatgttatggttgtgtgcgagacggataaggccgttgaacttccagaagagattgcctgt
ctgggtatctggaaggaaaagatttatggaattagtaaggtgacagtctatgtcagataa

DBGET integrated database retrieval system