KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12239
Entry
HMPREF0837_12239  CDS       T01259                                 

Gene name
asnA
Definition
(GenBank) aspartate--ammonia ligase
  KO
K01914  aspartate--ammonia ligase [EC:6.3.1.1]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00250  Alanine, aspartate and glutamate metabolism
snc00460  Cyanoamino acid metabolism
snc01100  Metabolic pathways
snc01110  Biosynthesis of secondary metabolites
snc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF0837_12239 (asnA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    HMPREF0837_12239 (asnA)
Enzymes [BR:snc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.1  aspartate---ammonia ligase
     HMPREF0837_12239 (asnA)
SSDB
Motif
Pfam: AsnA tRNA-synt_2
Other DBs
NCBI-ProteinID: ADI70467
UniProt: D6ZPC1
Position
complement(2050575..2051567)
AA seq 330 aa
MKKSFIHQQEEISFVKNTFTQYLKDKLEVVEVQGPILSKVGDGMQDNLSGVENPVSVKVL
QIPDATYEVVHSLAKWKRHTLARFGFGEGEGLFVHMKALRPDEDSLDATHSVYVDQWDWE
KVIPNGKRNIVYLKETVEKIYKAIRLTELAVEARYDIESILPKQITFIHTEELVERYPDL
TPKERENAICKEFGAVFLIGIGGELPDGKPHDGRAPDYDDWTSESENGYKGLNGDILVWN
ESLGGAFELSSMGIRVDEETLRRQVEITGDEDRLELEWHKSLLNGLFPLTIGGGIGQSRM
AMFLLRKRHIGEVQTSVWPQEVRDTYENIL
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaagaaaagttttatccatcaacaagaagaaatttcctttgtcaaaaacacttttacc
cagtatttgaaagataagctagaagttgtcgaagttcaaggtcctatcttgagtaaggtc
ggtgacggaatgcaggacaacctgtctggtgtggaaaatccagtatcggtcaaggttctc
caaatccctgatgctacttatgaagtggtgcactcacttgctaaatggaaacgccacacc
ttggctcgttttggctttggtgaaggagagggtctctttgtccacatgaaagcccttcgt
ccagatgaggattccttggatgcaacccactctgtttatgttgaccagtgggactgggag
aaggttatcccaaatggtaagcgtaacatcgtttatctaaaagaaacagttgagaagatt
tataaggctattcgtctgactgagctagctgttgaagcccgctatgacatcgagtctatc
ttgccaaaacaaatcacctttatccatacagaagaattggtagaacgctacccagacttg
acaccgaaagaacgtgaaaatgcgatttgtaaagaatttggagccgtctttttgattggt
atcggtggcgagttgccagatggtaaaccgcacgatggacgtgcaccagactatgatgac
tggacaagcgagtctgagaatggctacaagggtctaaatggtgatattcttgtctggaat
gagtctttaggtggagcctttgagttgtcttctatgggaattcgtgtagatgaagaaact
cttagacgtcaggtggaaattacaggtgatgaagaccgcttggaattggaatggcacaag
tctttgttgaatggtctattcccattgacaatcggtggaggaattggacaatctcgtatg
gccatgttcctacttcgcaagagacacatcggagaagtgcaaacaagtgtttggcctcaa
gaagtccgcgatacttacgaaaatattttgtag

DBGET integrated database retrieval system