KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12240
Entry
HMPREF0837_12240  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Other DBs
NCBI-ProteinID: ADI70468
UniProt: D6ZPC2
Position
2051541..2051705
AA seq 54 aa
MLMDKTFLHRQLLKNLINVLYTYFQEKKRENLKKISVTQNTDFIDLLVIATKDT
NT seq 165 nt   +upstreamnt  +downstreamnt
ttgttgatggataaaacttttcttcatagacaactcctcaaaaatttaataaacgtatta
tacacctatttccaagaaaagaaaagagaaaatttaaaaaaaatcagtgtcactcaaaac
actgatttcatagaccttttagtcattgcgaccaaagatacgtag

DBGET integrated database retrieval system