KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12241
Entry
HMPREF0837_12241  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
  KO
K06890  uncharacterized protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    HMPREF0837_12241
SSDB
Motif
Pfam: Bax1-I
Other DBs
NCBI-ProteinID: ADI70469
UniProt: D6ZPC3
Position
complement(2051679..2052386)
AA seq 235 aa
MFTEKEKWMNHTIIHDRAGLNQFYAKVYAFVGLGIGLSALVSGLMLTVFQSQLVYFLMQG
RLWLTIATFAELALVFVASSMASRNSPAALPVFLLYSVLNGFTLSFVVAFYTPGTVLSAF
VSSALLFFVMAAVGIFTKKDLSGIGRAMMAALIGLLIAMVVNIFLASGFFDYMISVAMVL
VFSGLIAWDNQKIRLAYEQSQGRVATGWVVSMALSIYLDFINLFLSILRIFGRND
NT seq 708 nt   +upstreamnt  +downstreamnt
atgttcacagaaaaggagaaatggatgaatcacactattatacatgaccgtgcaggtctc
aatcaattttacgctaaggtttatgcctttgttggtctgggaatcggactatctgctttg
gtatcaggccttatgttgacggtctttcagtctcagttggtttactttttgatgcagggg
cgtctctggttgaccattgctacttttgcggagttggctttggttttcgttgccagtagc
atggcttcaagaaatagtccagctgctcttccagtatttttactttactccgttttaaac
ggctttacccttagttttgtggtggctttctatactccgggtacagttttatctgccttt
gtatcgagcgcccttctcttctttgtcatggcggcagttggtatttttaccaagaaagac
ttgagtgggattggtcgagcaatgatggcagctctcattggtttactgattgctatggta
gtcaatattttcttggctagtggcttctttgattatatgattagcgtagccatggttttg
gttttttcagggttgattgcttgggataaccaaaagattcgcctcgcctatgaacaatca
caaggtcgtgtagcgacaggctgggtggtgtcaatggctctcagcatctatcttgatttt
atcaatcttttcctaagtattctacgtatctttggtcgcaatgactaa

DBGET integrated database retrieval system