KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12242
Entry
HMPREF0837_12242  CDS       T01259                                 

Definition
(GenBank) RNA methyltransferase, TrmH family
  KO
K03437  RNA methyltransferase, TrmH family
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:snc03016]
    HMPREF0837_12242
Transfer RNA biogenesis [BR:snc03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    HMPREF0837_12242
SSDB
Motif
Pfam: SpoU_methylase SpoU_sub_bind
Other DBs
NCBI-ProteinID: ADI70470
UniProt: D6ZPC4
Position
complement(2052418..2053158)
AA seq 246 aa
MTIITSKANSVVKNAKKLRQKKYRKSAYLIEGWHLFEEAVQAGVTIEKIFALENYRDQLA
TFSQTVWVSEDILLDLADSQTPQGIVAVVQKEEVGQADLSQGKFLFLEDVQDPGNVGTII
RTADAAGFTGVIVSDKSADIYSLKTLRSMQGSHFHLPIYRMTSQALLDETKKVAIPVLAT
TLSKDSVDYRELPSIENFVLVMGNEGQGISPLMAESADQLVHISMKGQAESLNVAVAAGI
LIFHLS
NT seq 741 nt   +upstreamnt  +downstreamnt
atgactattataacctcaaaagccaattctgtggtaaaaaatgccaagaaattacgccaa
aaaaaataccgcaagtctgcctacttgattgaaggctggcacttgtttgaagaagctgtc
caagctggagtgacgattgagaaaatctttgccctagaaaattatcgagatcagttagct
actttttcgcaaactgtctgggtgtcagaggatattttgctagatttggcggattctcag
actccacagggaattgttgccgtggttcaaaaagaagaagtaggacaagctgatttgagt
cagggcaagttcttgtttttggaagatgtgcaagatcctggtaatgtaggaactatcatt
cgaactgcggatgcagcaggttttacaggagtgattgtttcagataagtcggcagacatc
tacagtctcaaaaccctacgttccatgcaaggtagtcatttccatctgcccatttaccgg
atgactagtcaagcgcttcttgacgaaactaaaaaggtagctatcccagtgctagcaaca
accctatctaaagattctgttgattacagagaactgccttctatagaaaattttgtacta
gttatgggaaatgagggtcaaggaattagtccccttatggctgaaagtgcagaccagttg
gtccatattagcatgaaggggcaggccgagagtttgaatgttgcggttgcagccggtatt
ttaatcttccatttaagctaa

DBGET integrated database retrieval system