KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12243
Entry
HMPREF0837_12243  CDS       T01259                                 

Definition
(GenBank) acylphosphatase
  KO
K01512  acylphosphatase [EC:3.6.1.7]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00620  Pyruvate metabolism
snc00627  Aminobenzoate degradation
snc01100  Metabolic pathways
snc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMPREF0837_12243
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HMPREF0837_12243
Enzymes [BR:snc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.7  acylphosphatase
     HMPREF0837_12243
SSDB
Motif
Pfam: Acylphosphatase DUF5608
Other DBs
NCBI-ProteinID: ADI70471
UniProt: D6ZPC5
Position
2053192..2053470
AA seq 92 aa
MQKVRMIAQGRVQGVGFRWGVYSLALEIGGITGRVWNNDDGTVEILAQADSSAIMAKFIQ
EIRKGPTPFSKVSYLDVKLSNFPPYSDFKIAN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgcaaaaggttagaatgattgcccaaggtagggtacagggagtcggctttcgttggggt
gtttacagcttggcacttgaaattggtggcatcacaggtcgagtatggaataacgacgat
ggcacagtggaaatcttagcccaagcagactcatctgctatcatggcaaaatttatccaa
gaaatccgaaaaggaccgacacctttttcaaaagtaagctacttagatgtcaaactaagc
aactttcctccctactctgactttaaaatcgcaaattag

DBGET integrated database retrieval system