KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12244
Entry
HMPREF0837_12244  CDS       T01259                                 

Definition
(GenBank) membrane protein insertase, YidC/Oxa1 family
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc02024  Quorum sensing
snc03060  Protein export
snc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:snc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HMPREF0837_12244
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HMPREF0837_12244
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HMPREF0837_12244
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:snc03029]
    HMPREF0837_12244
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:snc02044]
    HMPREF0837_12244
Mitochondrial biogenesis [BR:snc03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    HMPREF0837_12244
Secretion system [BR:snc02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   HMPREF0837_12244
SSDB
Motif
Pfam: 60KD_IMP DUF3611 EMC3_TMCO1 DUF2418
Other DBs
NCBI-ProteinID: ADI70472
UniProt: D6ZPC6
Position
2053548..2054474
AA seq 308 aa
MKSIKRFALSAMGAAMLLVLTGCVNVDKTTGQPTGFIWNTIGAPMAEAIKYFATDKGLGF
GVAIIIVTIIVRLIILPLGIYQSWKATLHSEKMNALKHVLEPHQTRLKEATTQEEKLEAQ
QALFAAQKEHGISMFGGVGCFPILLQMPFFSAIYFAAQHTEGVAQASYLGIPLGSPSMIL
VACAGVLYYLQSLLSLHGVEDEMQREQIKKMIYMSPLMIVVFSLFSPASVTLYWVVGGFM
MILQQFIVNYIVRPKLRKKVREELAKNPPKASAFSKPSGRKDVTPEQPTAITSKKKHKNR
NAGKQRSR
NT seq 927 nt   +upstreamnt  +downstreamnt
gtgaaatctattaaacgttttgcactctcagctatgggagcggctatgttgcttgtcttg
actggttgtgtcaatgtcgataaaaccacaggtcagccaacaggatttatttggaatacc
atcggagcccctatggctgaagctatcaagtacttcgctactgataaaggtctaggcttt
ggtgtcgctatcatcatcgtaaccattatcgtgcgcttgattatcttgccacttggtatc
taccaatcatggaaggcaacgcttcactctgaaaagatgaacgccctcaagcacgtcctt
gagccacaccaaacgcgtctcaaagaagcgactactcaagaagaaaaactcgaagcccaa
caagctctctttgctgctcaaaaagagcacggtatcagcatgtttggcggtgtaggatgt
ttccctatcctccttcaaatgcctttcttctctgctatctactttgctgcccaacatact
gaaggggttgctcaagcaagctacctaggcattcctctaggttctccaagtatgattttg
gttgcctgtgctggtgtcctttactatcttcaatcgctcctttcacttcacggagtagaa
gatgaaatgcaaagagaacaaatcaagaaaatgatttacatgagcccactcatgatcgtc
gtcttctccctcttctcaccagctagtgtcacactttactgggttgtcggtggtttcatg
atgattctccaacagtttatcgtcaactatatcgttcgtccaaaacttcgcaaaaaagtc
cgtgaagaactagccaagaacccaccaaaagcaagtgctttctctaaaccaagtggacga
aaagacgttacccctgaacaaccaactgctatcacaagcaagaaaaaacacaaaaatcgt
aacgctggaaaacaacgttcgagataa

DBGET integrated database retrieval system