KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12245
Entry
HMPREF0837_12245  CDS       T01259                                 

Gene name
pflA
Definition
(GenBank) pyruvate formate-lyase 1-activating enzyme
  KO
K04069  pyruvate formate lyase activating enzyme [EC:1.97.1.4]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HMPREF0837_12245 (pflA)
Enzymes [BR:snc01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.4  [formate-C-acetyltransferase]-activating enzyme
     HMPREF0837_12245 (pflA)
SSDB
Motif
Pfam: Radical_SAM Fer4_12 Fer4_14
Other DBs
NCBI-ProteinID: ADI70473
UniProt: D6ZPC7
Position
complement(2054549..2055343)
AA seq 264 aa
MSEETIDYGQVTGMVHSTESFGSVDGPGIRFIVFLQGCHMRCQYCHNPDTWAMESNKSRE
RTVDDVLTEALRYRGFWGNKGGITVSGGEALLQIDFLIALFTKAKEQGIHCTLDTCALPF
RNKPRYLEKFDKLMAVTDLVLLDIKEINEEQHKIVTSQTNKNILACAQYLSDIGKPVWIR
HVLVPGLTDRDDDLIELGKFVKTLKNVDKFEILPYHTMGEFKWRELGIPYSLEGVKPPTA
DRVKNAKKLMDTESYQDYMKRVHG
NT seq 795 nt   +upstreamnt  +downstreamnt
atgtctgaagaaacaattgattatggacaagtgacaggaatggtgcattcgacagaaagc
tttgggtcagtagatgggcctggtattcgctttattgtctttttgcagggctgtcacatg
cgttgccagtattgccacaacccagacacttgggctatggagtccaataagtcacgtgaa
cggacggtagatgatgtcttgacagaggccttgcgctaccgtggtttctggggaaataag
ggtgggattacagtcagtggaggagaagctctcttgcagattgatttcctgattgctctc
ttcaccaaggctaaggaacaaggaatccactgtaccttggatacctgtgctcttcctttc
cgtaataaaccacgttaccttgagaagtttgacaaactcatggctgtcactgacttggtt
cttttggatatcaaggaaatcaacgaagaacagcacaagattgtcactagccaaactaat
aaaaatatcttggcttgtgcccagtatctatcagatattggaaaacctgtctggattcgc
cacgtgctagttccaggattgacagacagagatgatgacttgattgaacttggtaagttc
gtcaagaccctcaaaaatgttgataagtttgaaattctaccttatcacaccatgggtgag
ttcaagtggcgtgaacttggaattccatattccctcgaaggagtcaaaccaccaacagca
gatcgcgtcaagaacgctaaaaaactcatggataccgaaagttatcaagattatatgaaa
cgtgtacatggatag

DBGET integrated database retrieval system