KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12246
Entry
HMPREF0837_12246  CDS       T01259                                 

Definition
(GenBank) putative diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00300  Lysine biosynthesis
snc01100  Metabolic pathways
snc01110  Biosynthesis of secondary metabolites
snc01120  Microbial metabolism in diverse environments
snc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    HMPREF0837_12246
Enzymes [BR:snc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     HMPREF0837_12246
SSDB
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC
Other DBs
NCBI-ProteinID: ADI70474
UniProt: D6ZPC8
Position
complement(2055469..2056719)
AA seq 416 aa
MKTPFINREELEAIVAEFPTPFHLYDEKGIREKARAVNQAFSWNKGFKEYFAVKATPTPA
ILKILQEEGCGVDCSSYVELLMSHKLDFLGSEIMFSSNNTPDKEYAYARELGATINLDAF
EDIEHLERVAGIPEIISCRYNPGGVFELGTDIMDNPEEAKFGMTKDQLFEAFAILKEKGA
KTFGLHSFLASNTVTHLYYPELARQLFELAVEIKEKLGISLDFINLSGGIGVNYRPDQEP
NDIALIGEGVRKVYEEVLTSAGLGQVKIFTELGRFMLAPHGALVTRVTHKKETYRTYLGV
DASAVNLMRPAMYGAYHHISNVTHPDGPAEAVDVVGSLCENNDKFAVNRELPHTEIGDLL
VIHDTGAHGFSMGYQYNAKLRSAEILYTEEGKARQIRRAERPEDYFATLYGFDFEE
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgaaaacaccatttatcaatagagaagagttagaagcgattgttgccgagttcccgact
ccctttcacttgtatgatgagaaggggattcgtgagaaggcaagagctgtcaaccaagct
ttttcgtggaacaagggctttaaggaatattttgcagttaaggctactccaactccagct
attttgaaaattctccaagaagaaggttgtggtgtggactgctctagttatgtagagctt
ttgatgagccataaactggactttctgggttctgagattatgttctcttccaacaacacg
ccagacaaggaatacgcctatgcacgtgaattgggtgcgaccattaacttggatgccttt
gaagatattgaacatctggagagagtagcaggcattccagaaatcatctcttgtcgttat
aatcctggaggcgtttttgaactggggacagacattatggacaatcctgaggaggctaag
tttggcatgaccaaggaccagctctttgaagcctttgctatcttgaaggaaaaaggagcc
aagacttttgggcttcactccttcctagcgtccaataccgtgacccatctctattatcca
gagttggctcgtcagctctttgaactggctgttgaaatcaaggaaaagttgggcatttcg
ttagactttatcaatctttctggcggtattggtgttaattatcgtccagaccaggagccg
aacgatatcgccttgattggtgagggagttcgtaaggtgtatgaagaagttcttacgtca
gcaggtcttggtcaggtcaagattttcaccgaattgggtcgttttatgctggcacctcac
ggtgctctagtcacaagagtgactcataagaaggaaacctaccgtacctatctaggtgtg
gatgcctcagcagtcaacctcatgcgtccagctatgtacggagcttaccatcatattagc
aacgtgacccatccagatggaccagctgaagcggtagatgtggttggttcactctgtgaa
aacaatgataaatttgcagtcaatcgcgaactgcctcatacagaaatcggtgatttgctg
gtaattcatgatacaggtgcccacggattttcaatgggctaccagtataatgccaaatta
cgttctgcggaaatcctctataccgaagaaggtaaagcccgtcaaatccgccgtgcagag
cgccctgaggactattttgcaaccttatatggcttcgattttgaagaataa

DBGET integrated database retrieval system