KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12247
Entry
HMPREF0837_12247  CDS       T01259                                 

Gene name
purR
Definition
(GenBank) pur operon repressor PurR
  KO
K09685  purine operon repressor
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:snc03000]
    HMPREF0837_12247 (purR)
Transcription factors [BR:snc03000]
 Prokaryotic type
  Other transcription factors
   Others
    HMPREF0837_12247 (purR)
SSDB
Motif
Pfam: Pribosyltran PuR_N
Other DBs
NCBI-ProteinID: ADI70475
UniProt: D6ZPC9
Position
complement(2056786..2057613)
AA seq 275 aa
MKLRRSDRMVVISNYLINNPYKLTSLNTFAEKYESAKSSISEDIVIIKRAFEEIEIGHIQ
TVTGAGGGVIFTPSISSQDAKEMVEDLRTKLSESDRILPGGYIYLSDLLSTPAILKNIGR
IIAKSFMDQKIDAVMTVATKGVPLANAVANVLNVSFVIVRRDLKITEGSTVSVNYVSGSS
GDRIEKMFLSKRSLKAGSRVLIVDDFLKGGGTVNGMISLLREFDSELAGVAVFADNAQEE
REKQFDYKSLLKVTNIDVKNQAIDVEVGNIFDEDK
NT seq 828 nt   +upstreamnt  +downstreamnt
atgaaattaagaagaagtgatcggatggttgtcatttccaactatttgattaataatcct
tataaactaactagtctcaatacttttgctgaaaagtatgagtctgctaaatcatccatc
tcagaagatatcgtcattatcaaacgcgcctttgaggaaattgaaatcggtcatatccag
acagtgactggggctggcggaggtgtcatcttcacaccgtctatctcgagtcaggatgct
aaggaaatggttgaagacttgcgtaccaagttgtcagaaagtgaccgtatcttgccaggt
ggttatatctatctgtctgatttgcttagcacaccagccatcttgaaaaatattggtcgt
attattgccaaaagctttatggaccaaaaaattgacgcggttatgaccgtagcaactaag
ggtgtgccacttgcaaatgcagttgccaatgtcctcaatgtctcttttgtcattgtgcgc
cgtgacctgaaaattaccgaaggttcaactgttagcgtcaactatgtttcaggttcaagt
ggtgaccgtatcgagaaaatgttcctttcaaaacgtagtcttaaggcaggcagccgtgtc
ttgattgtggatgacttcttgaaaggtggcggaacggtcaacggtatgattagtctcttg
cgcgagttcgactcagaactggcaggtgtagcggtctttgcggacaatgcccaagaagaa
cgtgaaaagcagtttgactacaagtcactcttgaaggtaactaatattgatgtcaagaac
caagccatcgatgttgaggttggcaatatctttgacgaagataaataa

DBGET integrated database retrieval system