KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12248
Entry
HMPREF0837_12248  CDS       T01259                                 

Definition
(GenBank) nucleic acid-binding domain protein
  KO
K03698  3'-5' exoribonuclease [EC:3.1.-.-]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:snc03019]
    HMPREF0837_12248
Enzymes [BR:snc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     HMPREF0837_12248
Messenger RNA biogenesis [BR:snc03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     HMPREF0837_12248
SSDB
Motif
Pfam: HD tRNA_anti-codon TraI_2
Other DBs
NCBI-ProteinID: ADI70476
UniProt: D6ZPD0
Position
complement(2057880..2058833)
AA seq 317 aa
MRKNMKISHMKKDELFEGFYLIKSADLRQTRAGKNYLAFTFQDDSGEIDGKLWDAQPHNI
EAFTAGKVVHMKGRREVYNNTPQVNQITLRLPQAGEPNDPADFKVKSPVDVKEIRDYMSQ
MIFKIENPVWQRIVRNLYTKYDKEFYSYPAAKTNHHAFETGLAYHTATMVRLADAISEVY
PQLNKSLLYAGIMLHDLAKVIELTGPDQTEYTVRGNLLGHIALIDSEITKTVMELGIDDT
KEEVVLLRHVILSHHGLLEYGSPVRPRIMEAEIIHMIDNLDASMMMMSTALALVDKGEMS
NKIFAMDNRSFYKPDLD
NT seq 954 nt   +upstreamnt  +downstreamnt
atgaggaagaatatgaagattagtcacatgaaaaaagatgagctatttgaaggcttttac
ctaatcaaatcagctgacctgaggcaaactcgagctgggaaaaactacctagcctttacc
ttccaagatgatagtggcgagattgatgggaagctctgggatgcccaacctcataacatt
gaggcctttaccgcaggtaaggttgtccacatgaaaggacgccgagaagtttataacaat
acccctcaagtcaatcaaattactctccgcctgcctcaagctggtgaacccaatgaccca
gccgatttcaaggtcaagtcaccagttgatgtcaaggaaattcgtgactacatgtcgcaa
atgattttcaaaattgaaaatcctgtctggcaacggattgtccgaaatctctacaccaag
tatgataaggaattctactcctatccagctgccaagaccaaccaccatgcctttgaaacg
gggttggcttatcatacggcgaccatggtacgtttggcagacgctattagcgaagtttat
cctcagctcaataagagtctgctctatgcggggattatgttgcacgacttggctaaggtc
atcgagttgacgggaccagaccagaccgagtacacggtcagaggcaatcttcttggacat
atcgctctcattgatagcgaaattaccaagacagttatggaactcggcatcgatgatacc
aaggaagaagtcgttttgcttcgtcatgtcatcctcagtcaccacggcttgcttgaatat
ggaagtccagtccgtccacgtattatggaggcagagattatccatatgattgacaatctg
gatgcaagcatgatgatgatgtcaacagctctggctttggtggataaaggagagatgtcc
aataaaatcttcgctatggataatcgttccttctataaaccagatttagattaa

DBGET integrated database retrieval system