KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12250
Entry
HMPREF0837_12250  CDS       T01259                                 

Definition
(GenBank) thiamine diphosphokinase
  KO
K00949  thiamine pyrophosphokinase [EC:2.7.6.2]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00730  Thiamine metabolism
snc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    HMPREF0837_12250
Enzymes [BR:snc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.2  thiamine diphosphokinase
     HMPREF0837_12250
SSDB
Motif
Pfam: TPK_catalytic TPK_B1_binding
Other DBs
NCBI-ProteinID: ADI70478
UniProt: D6ZPD2
Position
complement(2060069..2060731)
AA seq 220 aa
MSEYKLSENNWTRVAVFAGGNRGHYRTDFDAFVGVDRGSLWVLEEDLPLALAVGDFDSVT
AEERQVIQKRAQYFVQARPEKDDTDLELALLTIFEQNPQAQVTIFGALGGRIDHMLANVF
LPSNPKLAPYMRQIEIEDGQNLIAYCSEGTSQLEPRSDYDYLAFMPVRDSQLTILGAKYE
LTEENFFFKKVYASNEYIDREVSVTCPDGYVVVLHSKDRR
NT seq 663 nt   +upstreamnt  +downstreamnt
atgagcgagtacaaactctcagaaaacaactggactagggttgcagtttttgcaggcgga
aaccgcggtcattatcggacagattttgatgcttttgttggggtggatcgaggctcgctc
tgggtcttggaagaagacttacctcttgctctagcagtcggagattttgattctgtgact
gcagaagagcgacaggtgattcaaaaacgtgcccagtattttgtccaagcccgaccagaa
aaggatgatacagatctggaattggctctcttaaccatctttgaacaaaatcctcaggct
caggtcactattttcggtgccttgggtggccgtattgaccatatgttggccaatgtcttt
ctacctagcaatcctaagttggcaccctatatgcgtcaaatagaaattgaggatgggcaa
aatttgattgcctattgttcagaagggaccagtcagctagaacctcgttcagactacgac
tatctagcctttatgccagttcgggatagccagctgactattcttggagctaagtatgag
ttgacagaggagaattttttctttaaaaaagtgtacgcttctaacgaatatatagatagg
gaagtgtcggtgacttgcccagatggttatgtggtcgtactgcatagcaaggacaggagg
tag

DBGET integrated database retrieval system