KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12251
Entry
HMPREF0837_12251  CDS       T01259                                 

Gene name
rpe
Definition
(GenBank) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00030  Pentose phosphate pathway
snc00040  Pentose and glucuronate interconversions
snc01100  Metabolic pathways
snc01110  Biosynthesis of secondary metabolites
snc01120  Microbial metabolism in diverse environments
snc01200  Carbon metabolism
snc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF0837_12251 (rpe)
   00040 Pentose and glucuronate interconversions
    HMPREF0837_12251 (rpe)
Enzymes [BR:snc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     HMPREF0837_12251 (rpe)
SSDB
Motif
Pfam: Ribul_P_3_epim QRPTase_C BKACE
Other DBs
NCBI-ProteinID: ADI70479
UniProt: D6ZPD3
Position
complement(2060694..2061413)
AA seq 239 aa
MKIVEKPIKKSAKKFQNKEKPMSQYKIAPSILAADYANFEREIKRLEATGAEYAHIDIMD
SHFVPQISFGAGVVESLRPHSKMVFDCHLMVSNPEHHLEDFARAGADIISIHVEATPHIH
GALQKIRSLGVKPSVVINPGTPVEAIKHVLHLVDQVLVMTVNPGFGGQAFLPETMDKVRE
LVALRQEKGLNFEIEVDGGIDDQTIAQAKEAGATVFVAGSYVFKGEVNERVQTLRKQLD
NT seq 720 nt   +upstreamnt  +downstreamnt
ttgaaaatcgtagagaaacctataaaaaagtcagcaaaaaaattccaaaataaggagaaa
cctatgtctcaatacaagattgctccgtcaattctggcagcagattatgccaactttgaa
cgtgaaatcaaacgtctagaagcaactggggcagaatatgcccatatcgatatcatggac
agtcattttgtaccgcaaatcagttttggtgcaggtgtggtcgagagccttcgtcctcat
agtaagatggttttcgattgccacttgatggtgtcaaaccctgagcatcatctggaagat
tttgcgcgtgcaggtgcagacatcatcagtatccatgtagaagcaacgcctcatattcat
ggcgccctccaaaaaattcgttcactcggagttaagccttcagtcgttatcaatcctggc
acaccagttgaagccatcaagcacgtccttcatctagttgaccaagttttagtcatgacg
gttaatccaggttttggtgggcaagcctttctgccagaaaccatggataaggttcgtgag
ttggttgctcttcgtcaggaaaaaggtttaaactttgaaatcgaagtggatggtgggatt
gatgaccaaactattgctcaagccaaagaagctggtgcgactgtttttgtagcaggttcc
tatgtctttaagggagaagtcaatgagcgagtacaaactctcagaaaacaactggactag

DBGET integrated database retrieval system