KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12252
Entry
HMPREF0837_12252  CDS       T01259                                 

Gene name
rsgA
Definition
(GenBank) ribosome small subunit-dependent GTPase A
  KO
K06949  ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00730  Thiamine metabolism
snc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    HMPREF0837_12252 (rsgA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:snc03009]
    HMPREF0837_12252 (rsgA)
Enzymes [BR:snc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.100  thiamine phosphate phosphatase
     HMPREF0837_12252 (rsgA)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     HMPREF0837_12252 (rsgA)
Ribosome biogenesis [BR:snc03009]
 Prokaryotic type
  GTPases
   HMPREF0837_12252 (rsgA)
SSDB
Motif
Pfam: RsgA_GTPase RsgA_N MMR_HSR1 ABC_tran GTP_EFTU AAA_29 AAA_23 RNA_helicase AAA_22 NACHT AAA FeoB_N AAA_16 AAA_25 NTPase_P4 AIG1
Other DBs
NCBI-ProteinID: ADI70480
UniProt: D6ZPD4
Position
complement(2061361..2062239)
AA seq 292 aa
MQGQIIKALAGFYYVESDGQVYQTRARGNFRKKGHTPYVGDWVDFSAEENSEGYILKIHE
RKNSLVRPPIVNIDQAVVIMSVKEPDFNSNLLDRFLVLLEHKGIHPIVYISKMDLLEDRG
ELDFYQQTYGDIGYDFVTSKEELLPLLTGKVTVFMGQTGVGKSTLLNKIAPDLNLETGEI
SDSLGRGRHTTRAVSFYNLNGGKIADTPGFSSLDYEVSRAEDLNQAFPEIATVSRDCKFR
TCTHTHEPSCAVKPAVEEGTIATFRFDNYLQFLSEIENRRETYKKVSKKIPK
NT seq 879 nt   +upstreamnt  +downstreamnt
atgcagggacaaatcattaaagccttggcaggtttctactatgtggagagtgatggccag
gtttatcaaacacgcgcgcgtgggaatttccgtaaaaaaggccataccccttatgttggg
gactgggtagatttctctgccgaggaaaattcagaaggctatatcctcaaaattcacgaa
cggaaaaacagtctggttcgtccgcctattgtcaatatcgatcaagctgtagtaatcatg
tccgtcaaggaacctgattttaacagcaatttgctggatcgtttcttggttcttttggag
cacaagggcatccatcccattgtctatatttccaaaatggatttgttggaagatagggga
gaactggatttttaccagcagacctatggtgacatcggctatgactttgtgaccagtaaa
gaggaactcctgcctttgttaacaggcaaggttacggtttttatggggcagacaggtgtt
gggaagtcaactcttctcaacaaaatcgcaccagatctcaatcttgaaacaggagaaatc
tcagacagtctgggtcgtgggcgccatactactcgagctgttagtttttacaatctcaat
gggggtaaaatcgcagacacaccaggcttttcatctctggactatgaagtatcaagggct
gaagacctcaatcaggcctttccagagattgctactgtcagccgagattgtaagtttcgt
acttgtacccatacccatgagccgtcttgtgccgtcaagccagctgtagaagaggggacc
attgccaccttccgttttgacaactacctgcaattcctcagcgaaattgaaaatcgtaga
gaaacctataaaaaagtcagcaaaaaaattccaaaataa

DBGET integrated database retrieval system