KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12253
Entry
HMPREF0837_12253  CDS       T01259                                 

Gene name
ksgA
Definition
(GenBank) dimethyladenosine transferase
  KO
K02528  16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC:2.1.1.182]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:snc03009]
    HMPREF0837_12253 (ksgA)
Enzymes [BR:snc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.182  16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase
     HMPREF0837_12253 (ksgA)
Ribosome biogenesis [BR:snc03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    HMPREF0837_12253 (ksgA)
SSDB
Motif
Pfam: RrnaAD Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_31 NodS MTS
Other DBs
NCBI-ProteinID: ADI70481
UniProt: D6ZPD5
Position
complement(2062241..2063113)
AA seq 290 aa
MRIADYSVTKAVLERHGFTFKKSFGQNFLTDTNILQKIVDTAEIDDQVNVIEIGPGIGAL
TEFLAERAAQVMAFEIDHRLVPILADTLRDFDNVTVVNEDILKVDLAQHIQNFKNPDLPI
KVVANLPYYITTPILMHLIESGIPFCEFVVMMQKEVADRISAQPNTKAYGSLSIAVQYYM
TAKVAFIVPRTVFVPAPNVDSAILKMVRRPEPAVAVEDENFFFKVSKASFTHRRKTLWNN
LTGYFGKTEEVKDKLTKALDQAGLSPSVRGEALSLAEFAGLADALKGQGL
NT seq 873 nt   +upstreamnt  +downstreamnt
atgagaattgcagattatagcgtgaccaaggcagtgttggagcgtcacggttttaccttt
aaaaagtcctttgggcaaaatttcttgacggataccaatatccttcaaaaaattgtggat
acggctgaaattgatgatcaggtcaatgtcatcgaaatcgggccaggtattggtgccttg
acagaatttttggctgagcgtgcagcccaagtcatggcttttgagattgaccaccgtttg
gtgccaattttggcagatactctgcgtgattttgataatgtgaccgtagttaacgaagat
attctcaaggttgatttggcgcaacatatccagaattttaaaaatcctgacctgccaatc
aaggtagtggctaatttgccttactacatcacgacgcctattctcatgcacttgattgag
agtggcattcctttttgtgagtttgtggtcatgatgcagaaagaagtagcggaccgcatt
tcagcccagcctaacaccaaggcttacggtagcttgtctatcgccgtgcagtattacatg
acagccaaggttgcctttatcgtgcctcgtacggtctttgtgccagcgccaaatgtggat
tcagccatcttgaaaatggtgcgtcgtccagagccagccgtagcagtagaagatgagaac
tttttctttaaggtttccaaggctagttttacccatcgccgcaagaccttgtggaataac
ttgacaggttactttggtaagactgaagaggtcaaggacaagctgaccaaggctttggac
caggcaggcttgtcaccaagtgtgcgtggggaagctctcagcttggcagaatttgccggt
ctagcagacgcacttaaagggcaaggactctaa

DBGET integrated database retrieval system