KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12254
Entry
HMPREF0837_12254  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: Big_4
Other DBs
NCBI-ProteinID: ADI70482
UniProt: D6ZPD6
Position
complement(2063364..2063480)
AA seq 38 aa
MKNLPQTVELTVDDVEEDVDLTLPENRSYQEADFFDTQ
NT seq 117 nt   +upstreamnt  +downstreamnt
ttgaaaaatttacctcaaacggttgaactgacagtggatgatgtggaggaggatgtggat
ttgaccctacccgaaaatcgaagttatcaagaagctgatttttttgatactcaatga

DBGET integrated database retrieval system