KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12255
Entry
HMPREF0837_12255  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Other DBs
NCBI-ProteinID: ADI70483
UniProt: D6ZPD7
Position
complement(2063499..2063657)
AA seq 52 aa
MCEKIRIRRVSDYPSARGGLEDILIMENMTNHLLLVQIRVHGYLLDFASIEG
NT seq 159 nt   +upstreamnt  +downstreamnt
atgtgtgaaaaaatccgtattcgcagggtatctgattatcctagtgccagaggtggttta
gaagatatcctcatcatggaaaatatgaccaatcatctccttttggttcaaatccgagtg
catggctatttgcttgattttgctagtattgaagggtaa

DBGET integrated database retrieval system