KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12257
Entry
HMPREF0837_12257  CDS       T01259                                 

Definition
(GenBank) bacteriocin-associated integral membrane protein
  KO
K02004  putative ABC transport system permease protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:snc02000]
    HMPREF0837_12257
Transporters [BR:snc02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    HMPREF0837_12257
SSDB
Motif
Pfam: DUF1430
Other DBs
NCBI-ProteinID: ADI70485
UniProt: D6ZPD9
Position
complement(2064293..2066326)
AA seq 677 aa
MMKRLFILISMVLVSLYMVITSVDHREEILFGNYPSVDVTGMMINQPVASREEVTEVLSH
LAVEHNSLIARRIVEPNEAGETLFTYATYGEGELPEGLTISSKESAETSDLLGSYLIVSG
SLDGVSLQTTLKELGYQGFVSNGEDPFSIVLLLAATPMVLLSLAIFLLTFMSLTLIYRIK
SLRQAGIRLIAGESLFGVALRPVLEDVRQFICSVLVSSLLGLGILWYQGALFMATVQLVI
IALLLYGLTLAGISTLLSVVYLLGLQENSLVDLLKGKLPLKRMMTLMMVGQLLAVLVVGL
SATALLPNYREMQEMEKASDKWSQSSDRYRLSFGWSSAFADEEGMRKDNREWQTFTEERL
ANTDSFYIMSNVDNFSDGVEVDLDGNRLSDYTPSGNVIYVSPRYLIEEKITVSSEFMDKM
QNLSEGEFGLILPESLREQSAYYQGLFTDYLQNFSSESVEVTSQKHYLPQVRLAFTETGQ
ERFLYNDGYKTTRQYLKDPIIVVLTPQATGTRPVAGMLWGTTANSALKLDRYGDSITALK
EQGLYHKVSYLVKSQLFFAKVLNDKRVEFYSLLIGTILTLSTAILLFDSMNLLYFEQFRR
ELMIKRLAGMTIYELHGKYLLAQGGVLLLGLVLSSILTRDGLISALVVALFTLNALLILV
RQDKKEEAGSMAVLKGK
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgatgaaacgtttatttattttgatttcaatggtattggtatcgctttatatggtgata
acttccgttgaccatcgagaagagattttatttggtaactatccttctgttgatgtgaca
ggaatgatgataaatcaaccagtagctagtcgcgaagaggtgacagaggttttgagtcac
ttggcggtagagcataatagtctcatcgcccgtcgaatcgttgagccaaatgaagctgga
gaaacactctttacctatgccacttatggtgagggagagcttccagaaggtctgaccatt
tcctccaaggagagtgcagaaacgagtgatttattagggtcttacttgattgtgtcagga
agtttggatggagtgagcttacagaccaccttgaaagaacttggctatcaaggctttgtt
tcgaatggagaagatccattttcgatagtcttactattggcggccacccctatggtgcta
ctgagtttagctatttttctgctgacctttatgagtctgaccctgatttatcggatcaaa
tcccttcgtcaggcagggattcgcttaatagctggtgagagcttgtttggagttgctctc
agaccagtgttagaagatgtgagacagtttatctgctcagtgctggtatccagtcttttg
ggattggggattctctggtatcaaggtgccttgtttatggcaacggtgcaactggtcatc
attgctcttctactttatggattgaccctggcagggatttctaccttactaagtgtcgtc
tatctacttggtttacaggaaaatagtctggtggatctattgaaagggaaactccctctc
aaacgtatgatgacattaatgatggtggggcaactcttagctgtattggtggtcggcttg
agtgcgacagctctcctccccaactaccgtgaaatgcaggagatggagaaggcaagcgat
aaatggagccagtcctcagaccgttaccgtctctcctttggttggtctagtgcatttgcc
gatgaagaaggaatgcgtaaggataatcgtgagtggcagacatttactgaagaacggtta
gccaatacagactctttttatattatgagcaatgttgacaatttctcagatggagtagaa
gtggacctagatggcaatcgtctcagtgactacacaccgtcagggaatgttatctatgtc
tcaccgcgctatctgatagaggaaaagattaccgtttcttcagagtttatggacaagatg
caaaacttgtctgagggagagtttgggctgatcttgcctgagagcttgcgagagcagtct
gcctactaccaaggattgtttacagattacctgcaaaacttttcatctgaaagtgtagaa
gtgacgagtcagaaacactacctcccacaggtaaggctagcttttacagaaacaggacag
gaacgtttcctctataatgatgggtacaagacaacacgccagtacctaaaagatccgatt
attgtagttctaacgccgcaagcgactggaacaagacctgttgcagggatgttgtgggga
actacggctaatagtgccttgaaactagatcgatatggagacagcatcacagctctaaaa
gagcaaggtctgtatcacaaggtttcttacttggtaaaaagccagctattttttgccaag
gtactaaatgacaaacgggtggagttttactctctccttattgggacgattttgaccctg
tctacggctatcttgttatttgattccatgaatcttctctattttgagcagttcagacgg
gagcttatgattaaacgtcttgctggtatgacaatctatgagcttcatggcaagtattta
ctggcgcaaggaggagttctcttgcttggcctagtcctatctagtattttgacaagagat
ggtttgattagcgctctagttgtagctttgtttacgcttaacgccctcttgattttagta
aggcaggacaaaaaagaagaagctggtagcatggcagtattgaaaggaaaataa

DBGET integrated database retrieval system