KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12259
Entry
HMPREF0837_12259  CDS       T01259                                 

Gene name
rnmV
Definition
(GenBank) ribonuclease M5
  KO
K05985  ribonuclease M5 [EC:3.1.26.8]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HMPREF0837_12259 (rnmV)
Enzymes [BR:snc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.8  ribonuclease M5
     HMPREF0837_12259 (rnmV)
SSDB
Motif
Pfam: DUF4093 Toprim_4 Toprim TauD
Other DBs
NCBI-ProteinID: ADI70487
UniProt: D6ZPE1
Position
complement(2067562..2068122)
AA seq 186 aa
MKEKISQVIVVEGRDDTVNLKRYFDVETYETRGSAINDQDIERIQRLHQRHGVIVFTDPD
FNGERIRRMIMTVIPTVQHAFLKRDEAVPKSKTKGRSLGIEHASYEDLKTALAQVTEQFE
HESQFDISRSDLIRLGFLAGADSRKRREYLGETLRIGYSNGKQLLKRLELFGVTLAEVEE
AMKSYE
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaaagagaaaatttctcaagttatcgtggttgaaggtcgcgatgatacggtcaatctc
aaacgttatttcgatgtggagacctatgagactcgaggttctgccatcaatgatcaggat
atagagcggattcagcgcctgcaccaacgtcatggagtcattgtctttacagacccagat
tttaatggggaacggattcggcgcatgatcatgacggtcattccaacagttcagcatgcc
tttctcaagcgagatgaagctgttcccaagtccaagaccaaggggcgttctctgggaatt
gagcatgccagctatgaagacctgaaaacggctctagctcaggtgacagaacaatttgaa
catgagagtcagtttgacattagtcgtagcgacttgattcgccttggttttctagcaggg
gcagacagccgtaagcgtagagaatatctcggagagactctccgaatcggctattctaac
ggcaagcaactcctcaaacgcctagagttgtttggggttactttggcagaagtggaagaa
gctatgaaatcttatgagtag

DBGET integrated database retrieval system