KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12262
Entry
HMPREF0837_12262  CDS       T01259                                 

Gene name
rpmH
Definition
(GenBank) ribosomal protein L34
  KO
K02914  large subunit ribosomal protein L34
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:snc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HMPREF0837_12262 (rpmH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:snc03011]
    HMPREF0837_12262 (rpmH)
Ribosome [BR:snc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HMPREF0837_12262 (rpmH)
  Bacteria
    HMPREF0837_12262 (rpmH)
SSDB
Motif
Pfam: Ribosomal_L34
Other DBs
NCBI-ProteinID: ADI70490
UniProt: D6ZPE4
Position
complement(2070377..2070511)
AA seq 44 aa
MKRTYQPSKLRRARKHGFRNRMSTKNGRRVLAARRRKGRKVLAA
NT seq 135 nt   +upstreamnt  +downstreamnt
gtgaaacgtacttatcaaccaagtaaacttcgtcgtgcgcgcaaacacggattccgtaac
cgtatgtcaactaaaaatggtcgtcgcgtattggcagctcgtcgtcgtaaaggacgcaaa
gttttggctgcataa

DBGET integrated database retrieval system