KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12264
Entry
HMPREF0837_12264  CDS       T01259                                 

Definition
(GenBank) universal stress family protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: Usp
Other DBs
NCBI-ProteinID: ADI70492
UniProt: D6ZPE6
Position
2072480..2072932
AA seq 150 aa
MAQRYQNIMVAIDGSKEADLAFVKGVHSALRNDAKLTIAHVIDTRALQSVSTFDAEVYEE
LQVDAESLMKEYEKRAKDAGVADVHIVIEMGNPKTLLARTIPDAEEVDLILVGATGLNAF
ERLLVGSSSEYILRHAKVDLLVVREQEKTL
NT seq 453 nt   +upstreamnt  +downstreamnt
atggcacaacgttaccaaaatatcatggtcgcaatcgatggttctaaggaagcggacttg
gcttttgtcaagggagttcattctgctctacgaaacgacgctaaactcaccatcgcacat
gtcattgacacacgcgctctccaaagcgtatccacctttgatgctgaagtttacgaagaa
ctccaagtcgacgctgaaagtctgatgaaagagtacgaaaaacgtgctaaagatgctggg
gtagcagatgttcatatcgtcattgaaatgggaaatccaaagaccctgctagcacgtact
attccagatgccgaggaagtggacctcatcctcgttggcgcaactggtctcaacgccttt
gaacgcctcttggtcggctcttcatctgaatatatactccgccatgctaaggtcgatttg
ctggttgtgagagaacaagaaaaaaccttataa

DBGET integrated database retrieval system