KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12266
Entry
HMPREF0837_12266  CDS       T01259                                 

Definition
(GenBank) Asparaginase
  KO
K01424  L-asparaginase [EC:3.5.1.1]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00250  Alanine, aspartate and glutamate metabolism
snc00460  Cyanoamino acid metabolism
snc01100  Metabolic pathways
snc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF0837_12266
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    HMPREF0837_12266
Enzymes [BR:snc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     HMPREF0837_12266
SSDB
Motif
Pfam: Asparaginase Asparaginase_C DUF3137
Other DBs
NCBI-ProteinID: ADI70494
UniProt: D6ZPE8
Position
2074421..2075383
AA seq 320 aa
MPKKILVLHTGGTISMQADASGAVVTSSDNPMNHVSNPLEGIQVHALDFFNLPSPHIKPK
HMLVLYQKIKEEADNYDGVVITHGTDTLEETAYFLDTMEVPHMPIVLTGAMRSSNELGSD
GVYNYLSALRVASDDRAADKGVLVVMNDEIHAAKYVTKTHTTNVNTFQTPTHGPLGLIMK
QEILYFKTAEPRVRFDLDHIQGLVPIISAYAGMTDELIDMLDLEHLDGLIIQAFGAGNIP
KETAQKLESLLQKGIPVALVSRCFNGIAEPVYAYQGGGVQLQKAGVFFVKELNAQKARLK
LLIALNAGLTGQALKDYMEG
NT seq 963 nt   +upstreamnt  +downstreamnt
atgcctaagaaaatccttgttttacatacgggtggaactatttccatgcaggccgatgct
tctggcgctgttgtgacgagttcagataatcccatgaaccatgtgtccaacccacttgaa
ggaatccaagtccacgccttggacttttttaaccttccaagtccccatatcaaacccaaa
catatgctggtcctctaccagaaaattaaagaggaagcagataactacgatggagtggtg
atcacacacggaaccgatactttagaggaaacagcctatttccttgataccatggaagtt
ccccatatgcctatcgttctaacaggagccatgcgtagctccaatgagctcggtagtgat
ggtgtttataattacctaagtgctttacgagtggccagcgatgacagggctgctgacaaa
ggagttttggtcgttatgaacgatgaaatccacgctgccaagtatgtcaccaaaacacat
acgactaatgtcaacaccttccagactccaacacatggccccctcggtctcatcatgaaa
caggaaatcctctacttcaaaacagctgaacctcgtgttcgctttgaccttgatcacata
caaggtttagtccctatcatctcggcttatgctggtatgacagatgagctgattgatatg
ctggatttagaacacttggacggtttgattatccaagccttcggagctggtaatattccc
aaagaaacggctcaaaaattagaaagccttctgcaaaaaggaatcccagtcgctctggta
tcacgatgctttaacggtattgccgagcctgtttatgcctaccaaggtgggggcgtacag
ttgcaaaaagcaggcgttttctttgttaaagaactcaacgcccaaaaagcccgcttgaaa
ctcctcatcgccctcaatgccggactaacaggacaggctttgaaagactatatggaaggc
taa

DBGET integrated database retrieval system