KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12269
Entry
HMPREF0837_12269  CDS       T01259                                 

Definition
(GenBank) response regulator receiver domain protein
  KO
K07693  two-component system, NarL family, response regulator DesR
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:snc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HMPREF0837_12269
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:snc02022]
    HMPREF0837_12269
Two-component system [BR:snc02022]
 NarL family
  DesK-DesR (membrane lipid fluidity regulation)
   HMPREF0837_12269
SSDB
Motif
Pfam: Response_reg GerE HTH_24 Sigma70_r4_2 HTH_11 LysR_substrate HTH_38 Sigma70_r4 HTH_40
Other DBs
NCBI-ProteinID: ADI70497
UniProt: D6ZPF1
Structure
PDB: 
4HYE 4E7P 4ZMS 4ZMR 4E7O

Position
complement(2077159..2077758)
AA seq 199 aa
MKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVKT
GLEVLEWIRSERLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSVADLMQTLHTVLEG
RKEYSPELMEVVMTRPNPLTEQEIAVLKGIARGLSNQEIADQLYLSNGTIRNYVTNILSK
LDAGNRTEAANIAKESGWL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaaagtattagtcgcagaagatcaaagtatgttgcgagatgccatgtgtcaattactc
acgcttcaaccagatgtggagtctgtccttcaagccaagaatgggcaagaagcaatccaa
ctattagaaaaggagtctgtagatatcgccatccttgacgtagaaatgcctgttaagaca
ggtcttgaagtcttggagtggatacgatcagaaaggcttgaaacaaaggtggttgtggtg
acgaccttcaagcgtgctgggtattttgaacgtgcggtcaaggctggagtggatgcttat
gtattaaaggaacgaagcgttgcagacctcatgcaaaccttgcacaccgtcctcgaagga
cgcaaggagtattcgcctgaattgatggaagtggtgatgacccgtcccaatccgttgaca
gaacaagagattgctgtcttaaaggggatcgcccggggcttatccaaccaagaaatcgca
gatcagctttacctctcaaacggaactattcgaaactatgtcaccaatattctttcaaaa
ttggatgctggtaatcgaacagaggcagctaatatcgcaaaagaatctggttggttatga

DBGET integrated database retrieval system