KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12270
Entry
HMPREF0837_12270  CDS       T01259                                 

Definition
(GenBank) histidine kinase
  KO
K07778  two-component system, NarL family, sensor histidine kinase DesK [EC:2.7.13.3]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:snc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HMPREF0837_12270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:snc01001]
    HMPREF0837_12270
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:snc02022]
    HMPREF0837_12270
Enzymes [BR:snc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HMPREF0837_12270
Protein kinases [BR:snc01001]
 Histidine kinases
  NarL family
   HMPREF0837_12270
Two-component system [BR:snc02022]
 NarL family
  DesK-DesR (membrane lipid fluidity regulation)
   HMPREF0837_12270
SSDB
Motif
Pfam: HisKA_3 HATPase_c HATPase_c_2 DUF4460
Other DBs
NCBI-ProteinID: ADI70498
UniProt: D6ZPF2
Position
complement(2077760..2078857)
AA seq 365 aa
MLERLKSIHYMFWTSLIFMLFPILPVVIGELPAWHLLVDILFVVTYLGVLITKNQRLSWL
FWGIMLVYVAGNTAFVAGNYIWFFFFLSNILIYHFGVRSLKSLHVWTFLLAQVLVVGRLL
IFQRIEVEFLVYMLVILTFVDLMTLGSVRIRLVEDLKEAQVKQNTQINLLLAENERNRIG
QDLHDSLGHTFAMLSVKIDLALQLFQMQAYPQVEKELREIQQISKESMREVRTIVENLKS
RTLTSELETVKKMLEIAGIEVETDNQLDTASLTQELESMASMILLELVTNIIKHAKASKA
YLKLERTEKELILTVSDDGCGFAFLKGDELHTIRDRVFPFSGEVSVISQKHPTEVQVRLP
YKERN
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgcttgaaagactgaaaagcatacactatatgttttggaccagtttgatttttatgctt
tttcccatcctacctgtagtgattggggagcttcctgcttggcatttattggttgatatt
ctatttgtagtgacgtatttgggtgttttaataactaagaaccagcgcctatcttggctt
ttctgggggatcatgctggtctatgtagctgggaataccgcctttgttgctgggaattat
atctggtttttctttttcctttccaatatcttaatttatcattttggcgtacgtagttta
aagtctttacatgtatggacatttctccttgctcaagtccttgttgtggggcgacttttg
atttttcagagaatcgaagttgagtttctagtctatatgcttgtaattcttacttttgtc
gatttgatgactttgggctcggttcgaattcgccttgtcgaggatttgaaagaagctcag
gtcaagcaaaatacccagataaatctattgctagcagaaaatgagcgcaatcgtatcggt
caggatttgcatgatagtctgggacatacctttgctatgcttagtgtcaagatagatcta
gccttgcagctatttcaaatgcaggcttatccacaagtggaaaaggaattaagagaaata
cagcaaattagcaaagaatcaatgcgtgaagttcgaaccattgtggaaaatcttaagtct
agaactttgacatccgaactagagactgtgaaaaagatgttagaaattgctggaattgag
gtggaaacagataaccaactagatactgctagccttactcaagaattggagtcaatggct
tctatgattttgcttgagttggtgaccaatatcatcaaacatgccaaagcgtctaaagct
tacttaaaattagaacggacagagaaggaactcattttaacagtaagtgatgatggctgc
ggctttgcttttctaaaaggagatgagctccatacaatccgagatcgtgtttttccattt
tcaggagaagtaagtgtaatcagtcagaaacatccaacggaagtgcaagttcgactacct
tataaggagagaaactaa

DBGET integrated database retrieval system