KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12271
Entry
HMPREF0837_12271  CDS       T01259                                 

Definition
(GenBank) ABC-2 type transporter
  KO
K01992  ABC-2 type transport system permease protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:snc02000]
    HMPREF0837_12271
Transporters [BR:snc02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    HMPREF0837_12271
SSDB
Motif
Pfam: ABC2_membrane ABC2_membrane_3 ABC2_membrane_4 Mem_trans PrgI ABC2_membrane_2 ABC2_membrane_5
Other DBs
NCBI-ProteinID: ADI70499
UniProt: D6ZPF3
Position
complement(2078857..2079594)
AA seq 245 aa
MKRWIALSKIEFLLTKRQLIYYLLSVGMPTAFYLFFSGIYQDTPGEPANFMRDYLISMTA
FSMMSTTIFSFPAVLHTDKMNNWQKTLRHSPVNMVEYYLSKITSMLVDYLVSILVVFTVG
HFVRGVDMPLVKWVGAAILLIVGSIAFVALGLTLTLLPTSQLMSVVGNLLYLGLAVLGGL
WMPISLFPDWMQAVGKCLPTYQLMELLKTFLNEGGINLSATVYLLVFSAVLFGLTIYLQG
HKENA
NT seq 738 nt   +upstreamnt  +downstreamnt
atgaaacgatggatagcacttagtaagatagaatttttattgaccaaacgacaattaatc
tattatctattgtcggtagggatgccgacggctttctatttatttttttctggtatctat
caggacacaccaggtgaacccgcgaattttatgcgtgattacctcatctccatgactgcc
ttttccatgatgtcgacaactatcttctcatttccagctgttttacataccgataagatg
aacaactggcagaaaacattgcgtcatagccctgtaaatatggtagaatattatctatca
aagataacaagtatgctggttgattatttggtctcaattctggttgtttttacagttgga
cattttgtaagaggtgtagacatgcctctagtaaaatgggttggagctgcgattttgctg
attgtggggagtattgcttttgtagcacttggcttgaccttgactctcttaccaactagt
cagctgatgtctgttgtgggcaatcttctttatctaggattggctgttttaggcggactc
tggatgcccatttctttatttccagactggatgcaagcagttggtaagtgtctcccgacc
tatcaattgatggagttgctcaagaccttcttaaacgagggtggcatcaatctatcagcc
acagtttatttacttgttttttcagcagttttatttggtttgactatttaccttcaaggt
cataaggagaatgcttaa

DBGET integrated database retrieval system