KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12272
Entry
HMPREF0837_12272  CDS       T01259                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:snc02000]
    HMPREF0837_12272
Transporters [BR:snc02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    HMPREF0837_12272
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_23 RsgA_GTPase AAA_29 AAA_15 Dynamin_N IstB_IS21 AAA_22 AAA SbcCD_C AAA_33 TsaE AAA_14 YcgR PSD5 AAA_24 SpoVIF GTP_EFTU MMR_HSR1 cobW AAA_25 AAA_28 AAA_30
Other DBs
NCBI-ProteinID: ADI70500
UniProt: D6ZPF4
Position
complement(2079596..2080480)
AA seq 294 aa
MTVVKVEKLSKKIKDKEILRNISFEINDGECVALIGPNGAGKTTLLDCLLGDKLVTSGQV
SIQGLPVTSSKLDYTRAYLPQENVIVQKLKVKELIAFFQRIYPNPLSNQEIDQLLQFVKQ
QKEQLAEKLSGGQKRLFSFVLTLIGRPKIVFLDEPTASMDTSTRQRFWEIVQELKAQGVT
ILYSSHYIEEVEHTADRILLLNKGELIRDTTPLAMRSEEIEKHFILPIAYKEVVEQSNLV
ENWTLKQDSLQVVTREADAFWELLAQAGCRMQEIEVNNRSLLNTIFEETQKGDN
NT seq 885 nt   +upstreamnt  +downstreamnt
atgactgtggttaaagttgagaaattgagtaagaaaataaaagacaaggaaattttgcgg
aacatctcctttgaaatcaacgatggtgaatgtgttgccttaattggtccaaatggtgcc
ggaaagacaacactcttagattgtttgcttggagataaactggtcacaagcggtcaagta
tctattcaaggtttaccagtgacgagttctaagttagactatactagggcttacctccct
caagaaaatgtaatcgttcagaaattaaaagttaaagagttgattgctttctttcaacgt
atctatccaaatcctttgagcaatcaggaaattgatcaactattgcagtttgtcaagcaa
caaaaagaacagttggcagaaaaattatcaggcggtcaaaagcgtctcttttctttcgtc
ttgaccttaattgggcgaccaaagattgtttttttagatgagcctactgcgtccatggat
acctcaactcgtcaacgtttttgggaaattgtccaggagttaaaagcgcaaggagtcacc
attctctattcgtcccattatattgaggaagtggaacacactgcagaccgcattttgctc
ttaaataagggagagttgattcgagatacgacgcctctagctatgcgtagcgaggaaata
gaaaagcactttatccttcctatagcttacaaggaagtcgtagagcagtcaaatttggtt
gaaaactggaccctaaagcaagattctttacaagtagtcactcgagaagcagatgctttc
tgggaactattagcccaagcaggatgtaggatgcaagaaatcgaagttaataatcgtagt
ttgttgaatacaatctttgaagagacgcagaagggagataactaa

DBGET integrated database retrieval system