KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12273
Entry
HMPREF0837_12273  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: zf-LITAF-like
Other DBs
NCBI-ProteinID: ADI70501
UniProt: D6ZPF5
Position
complement(2080467..2080661)
AA seq 64 aa
MKRGIIYFFIGLSLLVWLVEMFTDWFDQALLRQFICGALGFGFMIFVVFPMGMEWLKGES
HDCG
NT seq 195 nt   +upstreamnt  +downstreamnt
atgaagagagggatcatctatttctttatcggcctgtcactcttggtatggttagtggaa
atgtttactgattggtttgatcaagccttgcttcgccaattcatttgtggtgctttgggg
tttggatttatgattttcgtcgttttccctatgggaatggagtggttgaaaggagagtct
catgactgtggttaa

DBGET integrated database retrieval system