KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12274
Entry
HMPREF0837_12274  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: DUF3040
Other DBs
NCBI-ProteinID: ADI70502
UniProt: D6ZPF6
Position
complement(2080658..2080864)
AA seq 68 aa
MGEEEMRNKMIIAVSLVVAGVMTYLMFSGLDEDFYHFPWKVFAGFGIMSWLVREGLKLVR
DVKKEFEE
NT seq 207 nt   +upstreamnt  +downstreamnt
atgggggaagaagagatgagaaataaaatgattatcgcagtgagtttagtagtagcagga
gttatgacctatctcatgttttcgggattggatgaggatttctaccattttccttggaag
gtctttgctggctttggaatcatgtcttggcttgttagagaaggtttgaaattagtcaga
gatgtgaaaaaggagtttgaagaatga

DBGET integrated database retrieval system