KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12275
Entry
HMPREF0837_12275  CDS       T01259                                 

Definition
(GenBank) transposase, IS4 family
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: DDE_Tnp_1_4 DDE_Tnp_1 DDE_Tnp_1_6
Other DBs
NCBI-ProteinID: ADI70503
UniProt: D6ZPF7
Position
2081337..2082683
AA seq 448 aa
MNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQELFSQLKLKERISKYLVTNDQRRYCR
YSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQLASQPTLSRFLSRTDEETV
HSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEGVAYNAHYRAHGYHPLYAFEG
KTGYCFNAQLRPGNRYCSEEADSFITPVLERFNQLLFRIDSGFATPKLYDLIEKTGQYYL
IKLKKNTVLSRLGDLSLPCPQDEDLTILPHSAYSETLYQAGSWSHKRRVCQFSERKEGNL
FYDVISLVTNMTSGTSQDQFQLYRGRGQAENFIKEMKEGFFGDKTDSSTLIKNEVRMMMS
CIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLHVVGKCVRTGRKQLLKLSSLYAYSELFSA
LYSRIRKVNLNLPVPYEPPGRKASLMMH
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgaacagtttaccaaatcatcacttccaaaacaagtctttttaccaactatctttcgat
ggaggtcatttaacccagtatggtggtcttatcttttttcaggaacttttttcccagttg
aaactaaaagagcggatttctaagtatttagtaacgaatgaccaacgccgctactgtcgt
tattcggattcagatatccttgtccagttcctctttcaactgttaacaggttatggaacg
gactatgcttgtaaagaattgtcagctgatgcctactttccaaaattgttggaaggaggg
cagcttgcttcacagccaaccttatcccgttttctttccagaactgacgaggaaacagtc
catagtttgcgatgcctcaaccttgaattggtcgaattctttttacagtttcaccagcta
aaccaactcattgtagatatcgattctacccatttcacaacttatggcaagcaagaaggt
gttgcttataacgcccactatcgtgctcatggctatcatcctctttatgctttcgagggg
aagacaggttattgtttcaatgcccagcttcgtcctggtaatcgttattgttctgaagag
gcagacagctttatcacacctgttttagaacggtttaatcaacttctctttcgaatagat
agtggctttgcgacccccaaattatacgatttaattgaaaaaacagggcaatactacctc
ataaaactcaagaaaaatactgttctgagccgtcttggagacctttccctcccttgccca
caggatgaggacttaaccatcttgccccactccgcctactcagaaactctctatcaagca
ggatcttggtcgcacaagcgtcgtgtctgccagttctctgaacgaaaagaaggaaacttg
ttctacgatgttatttctctcgttacaaatatgacgagtggaacaagccaagaccagttt
cagctttatcgtggacgtggtcaagccgagaatttcatcaaggagatgaaggagggattt
tttggcgataaaacggatagttcaaccttaatcaaaaacgaagttcgtatgatgatgagc
tgtatcgcctacaatctctatctttttctcaaacatctagctggaggtgacttccaaact
ttaacaatcaaacgcttccgccatctttttcttcacgtggtaggaaaatgtgttcgaaca
ggacgcaagcagctcctcaaattgtctagtctctatgcctattccgaattgttttcagca
ctttattctaggattagaaaagtcaacctgaatcttcctgttccttatgaaccacctgga
agaaaagcgtcgttaatgatgcattaa

DBGET integrated database retrieval system