KEGG   Streptococcus pneumoniae ST556 (serotype 19F): MYY_0296Help
Entry
MYY_0296          CDS       T02087                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
snd  Streptococcus pneumoniae ST556 (serotype 19F)
Pathway
snd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:snd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MYY_0296
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:snd03011]
    MYY_0296
Ribosome [BR:snd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MYY_0296
  Bacteria
    MYY_0296
  Archaea
    MYY_0296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AFC93958
Position
269674..270018
Genome map
AA seq 114 aa AA seqDB search
MAEITSAKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTPNKAAEIILKVLNSAVA
NAENNFGLDKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRTAHITVAVAEK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattacttcagctaaagcaatggctcgtacagtacgtgtttcacctcgtaaa
tcacgtcttgttcttgataacatccgtggtaaaagcgtagccgatgcaatcgcaatcttg
acattcactccaaacaaagctgctgaaatcatcttgaaagttttgaactcagctgtagct
aacgctgaaaacaactttggtttggataaagctaacttggtagtatctgaagcattcgca
aacgaaggaccaactatgaaacgtttccgtccacgtgcgaaaggttcagcttcaccaatc
aacaaacgtacagctcacatcactgtagctgttgcagaaaaataa

DBGET integrated database retrieval system